Hod travels through the Marvel Universe and awakens to enjoy the surprise system of life.
As long as you enjoy a high quality of life, through eating, drinking and having fun, you can check in and get random rewards from all over the world!
You taste the premium Jamaican Blue Mountain coffee
Reward: 100,000 USD
You performed a stunt
Reward: Ultimate Master Fighting Skills
You successfully won the shooting competition
Reward: Ultimate Gun Weapon Master
At first the rewards were pretty ordinary.
Until one day, he suddenly discovered.
“Doing” can get better rewards…
You deeply understand Scarlet Witch Wanda
Reward: Phoenix Force
You help Gwen, a girl who longs to become an adult, realize her dream
Reward: Top-level comprehension talent
You fight against three female superheroes alone
Reward: Silver Super Template
While conquering and enjoying the pleasure of love.
Unknowingly, Hood gradually became an omniscient and omnipotent being!
Adult American Comics: Starting Social Security Black Silk Wanda
Chapter 1: Scarlet Witch comes to your door
Early morning, New York.
The light reflected from the Nasdaq big screen shone through the brown glass into the British-style cafe.
“According to our news, a vicious incident occurred in Germany yesterday, and the Avengers immediately stopped the crime.”
“But it is regrettable that Wanda Maximoff, codenamed Scarlet Witch, caused nearly sixty casualties due to her negligence!”
The large-screen TV hanging on the wall was broadcasting a news report.
“How despicable! These superheroes are just wreaking havoc everywhere under the pretext of their status!”
The well-dressed bearded boss placed the coffee on the young man’s desk, stared at the TV and cursed in disgust.
“Uncle Crewe, you really believe the media’s one-sided story!”
The young man sitting on the leather sofa picked up the silver spoon and stirred the Jamaican Blue Mountain coffee without even turning his head, and responded nonchalantly.
As he stirred with his silver spoon, the rich aroma of coffee filled his nostrils, and the corners of his mouth couldn’t help but rise slightly.
“Hodder, I experienced it myself! I saw with my own eyes that damn green monster smashed my house with the car I bought with a loan!”
“Fake! That’s the house I spent more than ten years saving to buy!”
When Kelu mentioned this, his already broad chest rose and fell violently.
On that day, he witnessed unprecedented despair, and even now he was still shaking with anger.
“Uncle Crewe, this is the third time you’ve said that.”
“And didn’t I compensate you with a better house and car later?”
Hood picked up a small piece of sugar and put it into the coffee, shaking his head helplessly.
Whenever there is news about superheroes on TV, Uncle Crewe can’t stop cursing.
“That’s different. Even so, you can’t do whatever you want!”
Uncle Kru put his hands on his hips, and his gray beard trembled with the breath he exhaled.
Facing Uncle Crewe’s answer, Hod put down his coffee and shook his head, “No hurry, sometimes we shouldn’t make conclusions too early, let’s wait and see!”
He knew better than anyone that the Avengers were not to blame for what had happened.
However, those media intend to force the Avengers to the forefront through overwhelming public pressure.
The purpose of doing so is nothing more than to force Tony Stark and others to agree to the government’s next superhero plan.
Get the Avengers to fully agree to government trusteeship.
In this practice, Wanda is the most critical victim.
The reason why he knew all of this clearly was because he himself was a time traveler.
Hodder picked up the coffee in his hand and took a sip of the rich coffee, his eyes lost in memories.
More than a year ago, he traveled through time and space to this world.
And also got the golden finger that time travelers must have: [Life surprise system, enjoy life, enjoy life! ]As the name suggests, as long as he enjoys a high-quality and comfortable life, the reward may be triggered.
For example, random rewards such as [millions of US dollars], [unlimited lubricant], [a hard and indestructible stick], etc.
[Ding! You tasted the premium Jamaican Blue Mountain coffee! ][Reward: 100,000 US dollars! ]“My dear Mr. Hodder, bullets don’t fly for long!”
Uncle Crewe’s elegant British accent brought Hod back to reality.
“That’s hard to say. Time will eventually prove what I say.”
Hodder put down his coffee cup and casually placed a stack of US dollars on the table.
Just as he was about to push the door open and leave, he seemed to remember something and turned back and said, “Uncle Hode, your coffee today is still very delicious. See you tomorrow.”
After saying that, the oak door of the coffee shop slowly closed, and the copper bell on it rang crisply.
“This kid…”
Crewe looked up at the figure through the brown glass of the shop door and smiled, then reluctantly stuffed the bills into his cash register.
Hood, who has a unique charm in his every move, is the biggest customer in his store.
Every day, he would walk into his coffee shop on time at four o’clock in the afternoon, and leave calmly after slowly sipping a few sips of coffee.
And every time before leaving, he never forgets to leave a tip of one thousand dollars.
…
……
The afterglow of the setting sun fell on the green pine trees.
Under the light, the pine needles look like needle tips painted with gold.
A black Cayenne was driving on the road leading to the suburbs.
“You have to live somewhere else once in a while!”
Hodder controlled the steering wheel with his right hand and placed his left hand outside the window to feel the breeze.
The scenery not far away made me feel happier.
His destination this time was a manor he owned in the suburbs.
That was a manor obtained through system rewards. Although it was located in a remote area, the scenery was exceptionally beautiful.
As we get farther away from the city, there are fewer and fewer houses around.
Even if you drive more than a kilometer, you may not see a house.
The long road was like a ruler, going straight into the woods.
In the quiet environment, you can occasionally hear the chirping of birds on the roadside.
“Itsf**kinTR3YWAY!”
“ItsKingofNewYorklookfortheQueen!”
“Uh you got the right one!”
“…”
A lively song came from the Bose speakers.
Hod, who was driving the vehicle, also hummed along with the song.
This slow-paced life makes him feel that life has a lot more fun.
Just as I was swaying slightly with the music, a woman in a red coat staggered out from the woods ahead!
“grass!”
Hodder’s face suddenly changed when he saw the figure that suddenly appeared.
He steered the car frantically with both hands, and his right foot almost braked directly into the fuel tank.
With a sharp brake sound, the Cayenne stopped steadily a few centimeters away from the woman in red.
Bang!
But, the woman actually fell heavily on his hood.
“A scammer?!” Hood was stunned at first, and his next thought was: “Cayenne or attractor?!”
Seeing that the woman didn’t raise her head for a long time, Hood hurriedly got out of the car.
When he saw the woman lying on the hood, his face froze.
The woman had blond hair, and her milky white skin was about to burst out from under the pressure of her T-shirt.
The blood-red coat on her body added a touch of indescribable beauty.
And she actually exuded a strong malt aroma.
Hodder was stunned for a long time before he murmured, “This… is Wanda?”
………
Three things to do when reading: read, collect, and reward!
Turn on lazy reading mode
APP audiobook (free)
High-quality audio, popular voice actors, offline listening
May 1st recharge gift
The activity is based on the actual VIP points received in a single transaction; VIP points are given in the form of coupons, and the higher the recharge amount, the longer the coupon expires. For example: recharge: 500 yuan to give 7500 VIP points, recharge: 1000 yuan to give 15000 VIP points
Event time: May 1 to May 5
Top up now
ActivityRegister as a Filo member and get 200 points![Register Now]Chapter 2: Flowers in Bloom, Deep into Wanda (Old Version)
“It’s actually Wanda.”
Hod took a step closer, and after a closer look, he confirmed that the person on his hood was actually Wanda.
I never expected to meet Scarlet Witch in such a remote place.
But she was lying on the hood, her breath carrying a strong smell of malt.
Even without getting close, I could tell that he must have drunk a lot.
“Huh~”
“You…why are you so drunk?”
After hesitating for a long time, Hood pulled Wanda’s hand to his shoulder and planned to help Wanda up.
Wanda, who was like a puddle of mud, raised her blurry eyes, and the area around her eye sockets was slightly red.
After noticing this strange face, Wanda asked with a choked voice: “Who…who are you?”
“Ms. Maximov, you are drunk.”
Hod grabbed Wanda’s wrist hanging on her shoulder and lifted her up.
“No…I’m not drunk!”
Hearing this, Wanda broke free from Hood and fell directly onto the hood of the car.
She knelt down on the ground, sobbing and shaking her head, a crystal tear sliding down her cheek.
“You need to rest.”
Looking at Wanda’s appearance, Hood sighed and stepped forward to help.
“Actually, I know… that everyone doesn’t like me…”
Wanda suddenly raised her head, her eyes were red under her messy hair, and tears had already covered her cheeks.
The trembling voice was filled with tears and the pitiful face was filled with helplessness.
Wanda’s painful expression and words made Hod suddenly realize.
What happened recently must have dealt Wanda a big blow.
In order to avoid massive casualties, Wanda had no choice but to throw the crossbones that was about to explode into the air.
The violent explosion directly broke through the building, causing heavy casualties.
It was obviously for the purpose of protecting more people, but what awaited her was not understanding, but endless pressure from public opinion.
“Actually, you’ve done a great job… No one hates you.”
Hood walked forward, ready to help Wanda up, and persuaded her in a gentle tone.
To put it bluntly, Wanda’s spiritual world is far more fragile than that of other superheroes.
It was inevitable that things would turn out like this. I guess the public opinion on the Internet has made her start to doubt herself.
“Really?”
Wanda raised her head and saw a deep ravine under her snow-white neck.
It is also because of this big movement that the milky white snow seems to be about to come out.
“Cough cough cough!”
Faced with this scene, Hood admired it gentlemanly, then looked away, subconsciously touched the tip of his nose and coughed twice.
It’s not that he is lustful, but any normal man would be unromantic if he didn’t appreciate the blooming flower.
“Are you lying to me?”
Wanda was very keen to notice Hood’s evasive eyes and asked with a questioning voice.
If he wasn’t lying to her, why would he avoid her gaze at this time?
This must be just to comfort her!
“How is that possible!” Hod looked at Wanda and said in a firm tone: “No one is perfect. No one can control the situation firmly in their own hands!”
Although Wanda is very powerful, it does not mean that she can do everything.
Even the big purple potato spirit couldn’t do what he wanted, let alone her.
“You… are right.”
Wanda took a deep breath and nodded slowly.
She had tried her best, but… she really didn’t expect…
“Don’t think too much. The ground is cold. Let me help you get in the car first!”
Hood came to Wanda’s side and leaned over, ready to help Wanda stand up.
Wanda nodded slightly to Hood who was so close to her. She did not struggle, but was obediently helped to the back seat by Hood.
“Send her back to the Avengers first.”
Seeing Wanda leaning in the back seat with a wandering look in her eyes, Hood shook his head helplessly.
Who would have thought that I would meet Wanda in a place like this.
Just as he straightened Wanda’s legs that were hanging outside the car door and was about to close the door.
A cold, slender little hand suddenly grabbed his wrist.
“What’s wrong?”
Facing Wanda with blushing cheeks, Hood asked with a puzzled look.
“You…are you telling the truth?”
“I really did nothing wrong?”
Wanda’s flashing eyes were like seeing a new star that belonged to her alone.
After what happened, all she faced was contempt.
The public’s lack of understanding and the officials’ selfishness made her unsure of what to do.
It was for this reason that she came to this secluded place to drink alone.
But I didn’t expect that at this moment, the person in front of me actually resolved his own knot.
He even stood firmly on her side.
“Yes, you have tried very hard!”
There was determination in Hodder’s voice.
And the next second, Wanda suddenly pulled back, and a red light flashed in her hand.
Then a force pushed him directly towards Wanda.
In this unexpected moment, Hood could only support his hands on both sides of Wanda’s shoulders.
The two of them fell into the back seat of the car in an instant, and their faces, which were so close, exhaled heavily.
At this moment, what wafts to your face is not only the aroma of wine, but also a faint scent of jasmine mixed with the scent of wood.
The face so close to him made his heart beat faster even though he was a veteran of many battles.
Wanda’s blue eyes, as bright as the stars, were like black holes, locking his gaze tightly.
“that……”
Hodder opened his mouth slightly, wanting to say something.
“Stop talking!”
Wanda closed her eyes, her eyelashes trembling constantly, just like a flower letting him pick it.
Huo De was stunned. He never expected that what happened next would unfold like this.
And if he couldn’t understand Wanda’s action, he would have lived so many years in vain.
He didn’t hesitate and kissed her directly.
When separated again, the water lines connected.
Wanda blinked her wet eyes, which were watery and sparkling like a clear lake.
delicate and charming…
The corners of her eyes were still red and seductive. Perhaps she was nervous at this moment, and the corners of her charming lips were trembling…
It has come to this!
If I retreat, wouldn’t that be Liuxia Hui!
“Bang!”
Hodder gritted his teeth, turned over and closed the car door.
He has always adhered to a principle: if something is offered to you, there is no reason to refuse it.
Seeing Hood’s actions, Wanda exclaimed: “What do you want to do?”
“Dry!”
Just under the setting sun.
The afterglow of the sunset fell on the black roof!
A black Cayenne fully demonstrates its proud shock absorbers!
Despite this, it still sways with the rhythm!
Chapter 3: Holding an umbrella to weather the Wushan rain, gain the power of the phoenix! (Old version)
I don’t know how much time has passed.
A blue dawn appeared on the horizon, and the light shone through the mist onto the earth.
“It’s already daybreak!”
“Looks like a titanium kidney is needed!”
Hodder sat on the hood, holding the cigarette to his lips.
The corners of his mouth slightly raised on his tired face, and his left hand supporting his body was still trembling slightly.
He struggled to take out the ZIPOO from his pocket.
A flickering flame shone.
It’s an experience that Hood will probably never forget.
“call……”
Hodder took a deep drag on his cigarette.
As expected, when you drive a Cayenne, girls will fall from the sky.
There was even a superhero falling down.
He looked back at the windshield behind him, his eyes softening a little.
Wanda closed her eyes tightly, probably because she was too tired and fell asleep.
[Ding! You had a wonderful night! ][Reward: Phoenix Power Fragment (without will)! ]Just as Hod was feeling the beauty of the smoke, the system panel suddenly appeared in front of him.
The system panel that suddenly appeared took his tired nerves a while to react.
“Wait, I actually got a fragment of the Phoenix Force?!”
When Hood came back to his senses, he was stunned for a moment. He never thought that he would get a reward for this!
Because he had thought before that if he wanted to enjoy life, this must be one of them.
Therefore, he tried everything that could be tasted in the world.
In addition, he also tried mountain climbing, racing, skydiving, and extreme cycling.
In short, he tried everything that could make life more exciting.
Also received a lot of awards.
But I didn’t expect that I would be able to obtain the power of the Phoenix this time.
What is Phoenix Force!
The power of the Phoenix is omnipotent and cosmic!
It is the embodiment of the original cosmic life force and emotional power!
No matter in which universe, the Phoenix Force is the most powerful existence!
One of the existences that countless creatures fear, it can cut or regenerate any part of the universe.
Or even destroy it completely and burn those things that should be eliminated – this is called the judgment of the Phoenix.
One description calls the Phoenix Force the embodiment of the passion of all things, the spark that brings life to the universe and the fire that will ultimately destroy it.
The power of the Phoenix in its heyday is incomparable even to the five great gods!
Although what we have obtained now is just a fragment of the Phoenix Force.
But even if it was just a fragment, he could clearly feel an extremely terrifying force flowing through his body.
Even his body was cleansed by this power!
Next second.
A fiery red phoenix suddenly appeared in his mind.
The moment the phoenix figure appeared, it rushed towards him with endless pressure.
In just a split second, he felt the pressure as if it could shatter his will!
And at this moment, the phoenix’s shadow disappeared from his mind in an instant.
“Is this the power of the Phoenix?!”
Hood’s Adam’s apple rolled up and down, and there was a hint of imperceptible fear in his murmurs.
Just now, he even suspected that the power of the phoenix would directly tear his consciousness apart and turn him into a vegetable.
Fortunately, the Phoenix power without consciousness is the real Phoenix power.
Otherwise, it will make people lose control of it at any time!
Qin is the most typical example!
But even she has never possessed the full power of the Phoenix!
Moreover, in the movie of his original world, Jean’s abilities had been greatly weakened.
In the end, he was defeated by Wolverine using love + immortality!
Even though it was only a fragment of the Phoenix Force, it gave Hood the ability to reach the level of a sub-godfather!
“I never thought that I would get such a great reward just for one night of love!”
Hood spit out a circle of eyes and flicked the cigarette butt in his hand away, and the sparks drew an arc in the air.
I have to say that this reward really surprised Hood.
I have received many awards before.
Draw a self-defense type reward.
For example, [Ultimate Fighting Master’s Martial Arts], [Ultimate Gun Weapon Master], [Micro Pistol – Cricket], etc…
But even so, compared with the current power of the Phoenix, it is obviously not enough.
“What on earth is going on?”
Hod put his right foot on the hood and supported his chin with his right hand, thinking secretly.
The most important thing now is to find a way to figure out how the system makes judgments!
Wouldn’t it be awesome if you could know exactly how to get higher-level rewards?
Appearance ?
Educational background?
money?
Race?
As ideas emerged one after another, they were rejected by Hood one by one.
Because in the past year, although he was not as rich as a country, he had never lacked money.
So we have already found the best in every aspect!
If it was just because of these, it would be impossible that it had never been triggered at all.
“etc!”
Just at this moment, an idea came to my mind.
“The system’s reward mechanism seems to be related to “quality of life”.”
“But this time Wanda and I got a reward!”
“If I want to collect the fragments, I have to…”
That makes sense.
When he rode a big horse before, he didn’t get so many good rewards.
Thinking about.
Hod looked at Wanda who was snoring softly in the back seat.
A thoughtful look appeared on his face.
He jumped off the hood and flexed his shoulder blades vigorously.
“In that case, we can only hold an umbrella and ride out the Wushan rain together!”
…………….Dividing line……………..
ps: Brothers, if you think it’s good, please give the author some free flowers. I will be very grateful. If one person gives me flowers, no matter how many flowers I give, I will add another chapter.
Feilu novel, Fei will make you look good!
Automatically subscribe to the latest chapters
Chapter 4: Humanoid Construction Site Pile Driver, Wanda is Angry! (Old Version)
The next morning.
In a magnificently decorated room.
Lying on the soft big bed, Wanda bit her red lips lightly and opened her eyes with a painful look.
What catches your eye is the dazzling ceiling.
Outside the floor-to-ceiling windows, the midday sun shines directly on the earth.
The smooth floor tiles outside the house reflected the dazzling light, just like the ripples on the lake.
“Hiss, it hurts!”
What followed was a feeling of pain all over the body as if it was falling apart.
It felt like being run over by a heavy truck, and even my mouth felt a slight pain.
Wanda looked at this unfamiliar environment with a bit of confusion in her eyes.
“Where is this?”
Wanda touched her clothes and realized that her scarlet combat uniform had been replaced with a men’s shirt with a faint scent of sandalwood cologne.
Her mind suddenly went blank, “I should have gone out for a drink yesterday afternoon…”
“But after drinking, I seemed to run into…”
“Hiss~”
Thinking of this, she still felt a little dizzy.
Wanda forced herself to continue recalling the details of last night.
But she frowned, because her memory came to an abrupt end at this moment!
Smelling the men’s perfume coming from the white shirt, she had already guessed what it was.
“I can’t be…”
After thinking about this, she couldn’t help but look flustered.
Combined with the pain in the lower body, I was sure something had happened!
Boom boom boom…
Just then, footsteps were heard in the wooden corridor outside the door.
The sudden sound caused Wanda’s already panicked brain to suddenly shut down.
The whole person was hidden in the quilt, with only a small gap showing.
A young and handsome man in a bathrobe walked in with an aluminum tray in his hand.
On top was a butter sandwich, a fried egg, and a glass of milk.
The faint aroma of butter also followed the taste and seeped into the cracks of the cup.
When Hood walked in, he saw a big bulge in the bedding on the bed, and the corners of his mouth couldn’t help but rise.
“Are you awake?”
Hodder asked in a gentle voice.
Even though they had only been together for a short while, he knew that Wanda didn’t like to cover herself with a blanket.
In fact, after he came back at noon, every time he covered her with the quilt, it would be pulled away.
So now it is certain that Wanda has woken up.
“You did it?”
Wanda puffed up her breath and poked her little face out of the gap.
Although I have forgotten a lot of things, I can still vaguely remember Hood’s face last night.
“Yeah, I did it!”
The corners of Hodder’s mouth rose, and a smirk appeared on his face.
After these words came out, Wanda was instantly angry and annoyed.
The little face became extremely rosy, as if it had been smoked by hot steam.
“you!”
Wanda’s cheeks puffed up with anger and she pulled away the soft quilt.
As I turned over and was about to get out of bed, I felt a sharp pain instantly.
“hiss!”
Her little face turned pale in an instant, and she knelt on the bed, covering her abdomen.
This tearing pain came from her abdomen, and she could only gasp in pain.
“Are you okay?” Hood quickly put down his breakfast and sat next to Wanda: “You are too crazy, you must have been hurt accidentally!”
After all, this went on from yesterday evening until almost noon the next day.
It was inevitable that it would turn out like this, not to mention that he had done an experiment this morning.
It’s a pity that if this happens too frequently, it seems that there is no way to trigger the effect a second time.
This should be like him going to taste coffee, and only drinking one cup a day.
I guess it’s to prevent him from being too greedy.
“Me?” Wanda pointed at herself angrily and spat out the last two words “Crazy?”
Although she vaguely remembered what happened, she couldn’t remember the details.
And saying this at this time made her feel ashamed and angry.
“Does it hurt?”
Hood did not answer Wanda’s question, but looked at Wanda with pity.
It would have been fine if she hadn’t asked this question, but when Wanda asked this question, she completely lost control of herself.
“What do you think!!!”
Crystal clear tears flashed in the corners of her clear eyes.
Even breathing became extremely rapid at this time.
This is like a spear as powerful as a dragon, how can it not hurt!
She even suspected that this damn man was the incarnation of a construction site pile driver.
This person really has no idea what it means to be gentle and considerate to women!
“Why don’t you eat something first to replenish your energy.”
Hodder pursed his lips and said with a slightly apologetic expression.
Even though it wasn’t my own initiative, it has already become like this.
It is only natural for him to transform into a caring and warm man. After all, this is his best quality.
Just as he reached out to pick up Wanda.
Buzz!!!
“Get out of my way!”
Following a buzzing sound, I suddenly noticed a tide of scarlet light bursting out all around me.
The surrounding furniture was also shaking.
Wanda’s eyes flashed red and she swung her slender, white arms violently.
Boom!
A scarlet beam of rage mixed with heroism suddenly pounced towards Hod.
At this moment, a hint of tenderness finally flashed in Wanda’s eyes.
The originally scarlet beam of light also softened a lot at this time.
But the red light still roared violently!
…………
Chapter 5: The Power of the Phoenix! The Terrifying World of the Soul! (Old Version)
“naughty.”
Facing the scarlet light that was coming like a surging tide.
Hood simply raised his hand and waved it gently, and the scarlet light dissipated like smoke.
!!!
“This… How is it possible!?”
Wanda’s eyes widened in disbelief.
Although at the last minute, she held back because of what happened between the two of them.
But even so, it is not something that ordinary people can easily block!
Not to mention that the action just now was full of casualness.
“Witch, you are so unreasonable.”
“It was you who seduced me first. I am just an innocent victim.”
“Even my innocence was taken away by you so rudely.”
“I haven’t even asked you to take responsibility yet, and you’re actually going to attack me!”
Huo De looked aggrieved, covering half of his face and complaining unwillingly.
“I?!”
“Haha, I took the initiative? How can this be…”
“It should be impossible…”
Wanda laughed in anger, and when Ben opened his mouth to refute, the vague memory in his mind became clear.
Because in her mind, it was indeed she who brought Hood into the car.
And she was basically the one who dominated what happened afterwards.
In an instant, her little face turned red and a burning feeling surged in her heart.
If I had known… I wouldn’t have drunk such a strong malt liquor!
“Although this is my first time, I still want to shoulder the responsibilities that a man should bear.”
“But you treated me like that, so you have to take responsibility for whatever you say!”
Hodder put on an aggrieved look.
However, after saying this, he still added something silently in his heart.
This was really the first time I had sex with Chaoying, and I had never had such an exciting experience before.
This feeling can only be described by the word “smooth”.
He couldn’t help licking his lips even when he thought about it.
“I don’t believe this is your first time!”
Wanda endured the pain, rolled her eyes impatiently, and pouted her mouth slightly.
She didn’t believe that someone could be so familiar with it and make people feel so comfortable for the first time!
Even though it was her first time, it didn’t mean she was a fool!
Whenever she thought of this scene, her cheeks became so red that they seemed to bleed.
But the emotions that followed made her feel even more aggrieved.
It was painful enough that he became the target of public criticism because of the Crossbones incident.
But I didn’t expect that just wanting to numb myself with alcohol would turn out like this.
The more she thought about it, the darker her eyes became.
“So you mean you are not responsible for me?”
Hod was very sensitive to Wanda’s change of mood, but he didn’t stop talking.
“I……”
Wanda, who was originally feeling uncomfortable, suddenly pulled herself out of that emotion after hearing this.
She bit her lips with an ugly expression, and her eyes were red and watery.
She looks shy, but makes her look even more charming and attractive.
“OK!”
Hod joked: “Then I will contact Mr. Tony Stark now and tell him what you did to me!”
Wanda’s face suddenly turned pale.
If she told Tony Stark about this, she would become a laughing stock to everyone in the world!
But at this moment, Hood had already taken out his cell phone from his pocket.
At this moment, Wanda’s heart became extremely conflicted.
She stretched out her right hand, and a ray of scarlet light flew towards Hord’s temple.
The next second, Hood, who was holding the phone, froze in place.
“We can only… erase his memory.”
Wanda was also very conflicted when making this decision.
Because this is something she will never forget in her life.
But at this time, this is the only way to delete the other person’s memory.
She let out a long breath and threw all the distracting thoughts out of her mind.
And the next second, she opened her eyes and peeked into Hood’s spiritual world!
huff!
What catches your eye is a fiery red phoenix.
The flames shot up into the sky, turning the entire white cloud into a sea of red clouds. A terrifying pressure emanated from the phoenix’s body.
“Is this his inner world?!”
Wanda was stunned. The phoenix looked very powerful.
The aura of destruction it exudes seems to be able to devour everything.
but…
Wanda actually felt it was very friendly and made her feel at ease.
To be precise.
It was after she had a deep contact with Hood’s inner world that she felt a strong sense of intimacy with him.
Like a friend I haven’t seen in years.
This made her feel a strong desire to get close to Hood whenever she looked at him.
Something to do with Phoenix?
“What are you doing?”
suddenly.
Hood, who was stunned on the opposite side, raised his hand and held Wanda’s slender white hand.
“you……”
At this moment, Wanda’s pupils kept trembling.
This is simply impossible!
You should know that even Asgard’s Thor can’t resist his mind control.
What’s more, he is just an earthling!
Chapter 6 God-level magic talent, special relationship between men and women! (Old version)
“Miss Witch, it’s fine if you’re irresponsible, but you still want to take action?”
Hood held Wanda’s slender little hand and looked at Wanda, who was wearing a shirt, with a smile.
I have to say, there is an indescribable sense of contrast when Wanda wears a men’s shirt.
“Have we met before?”
Wanda’s eyes widened, her bright eyes staring straight at Hood.
For some reason, Hodder gave her a sense of familiarity.
And it also has some special abilities!
Could it be that he had seen it in the Hydra laboratory?
After all, the man in front of him is very capable.
She kept thinking about it in her mind, but she had no relevant memory.
“No.”
Hod shook his head without thinking, kneading Wanda’s skin gently with his fingers: “My dear Miss Witch, there is no way to escape from your approach!”
In fact, at the moment Wanda invaded just now, the power of the Phoenix automatically emerged to resist Wanda’s power.
The Phoenix Force can resist all spiritual supplies, and the Phoenix Force and the chaos magic in Wanda’s body are among the three most ancient energy bodies.
It is also because of this reason that there is some connection and familiarity between each other.
“I……”
Facing Hood’s repeated questioning, Wanda lowered her head guiltily.
In fact, she also knew that if she had not used chaos magic at that time, things would never have turned out like this.
But let her be responsible?
How could she possibly answer this!
Although I was indeed being unreasonable in this matter.
Just as Wanda was thinking about how to answer.
Holding her wrist tightly, Hood, with his sturdy body of nearly 1.9 meters tall, suddenly moved forward, almost pressing down on her.
The strong hormones rushed over Wanda, making her heart flutter. She raised her head and said nervously, “Don’t do anything rash…”
Thoughts that are not suitable for children also emerged in my mind.
How long has it been since then, and now you have new ideas?!
“What do you mean by messing around? Aren’t you supposed to be responsible?”
Hod grinned and lowered his head, meeting Wanda’s eyes.
“that……”
Wanda avoided Hood’s gaze in panic, stammering and unable to speak.
Ding Dong!!!
At this time, the doorbell rang.
“Mr. Hod, Mr. Tony Stark is here!”
The manor maid’s voice was heard outside.
“Why is Tony here?!”
When Wanda heard the name, her mind went blank and the hairs on her back stood up.
She couldn’t even imagine what would happen if Tony Stark knew about this.
Hod looked at Wanda’s nervous expression and subconsciously smiled.
He let go of Wanda’s hand and ruffled her fluffy hair: “Don’t worry, he’s here to see me!”
A long time ago, Hood had obtained a share of Stark Group through system rewards.
He is also a small shareholder and keeps in touch with Tony from time to time.
“That’s good……”
Wanda breathed a sigh of relief.
Although I don’t know why Tony Stark is here.
But as long as it’s not directed at her, it’s fine.
But what Hood said next almost made her cry.
“You seem very happy!”
Hod moved closer to Wanda and hooked her fair and tender chin, “You must be obedient. You don’t want Tony to know about this, do you?”
I have to say, looking at Wanda’s angry and furious expression, he felt an indescribable pleasure.
Facing the burning breath, Wanda blinked her big eyes and bit her lower lip, not daring to resist at all.
This guy is too despicable, and the threatening words are simply…
Boom boom boom!
“Mr. Hodder, Mr. Stark is already in the reception room on the first floor.”
The maid’s voice sounded outside the door.
“I see!”
Hod responded, then turned around and stared at Wanda: “My lovely witch lady, this is your last chance, otherwise I will go to Tony to complain!”
“Complain?!”
“I should be the one to file the complaint!”
Wanda’s breathing became rapid. The dramatically undulating hillside looked particularly attractive against the backdrop of her shirt.
Although she was indeed more proactive, it was the other party who was taking advantage, and it even became a handle for the other party.
She simply couldn’t understand why the man in front of her was so righteous.
“You decide for yourself!”
Hodder looked at Scarlet Witch unscrupulously.
It has to be said that because of the other party’s identity, he actually felt a long-lost sense of spiritual happiness.
“Okay! I got it!”
Wanda snorted, looked around, and found the banknotes on the bedside table.
She crawled to the bedside table and picked up a pen and paper.
As soon as he turned around, he saw Hood’s burning eyes staring behind him.
“rogue!”
Wanda cursed under her breath before quickly writing down a series of phone numbers on a piece of paper. “This is my number. You can call me if you have anything!”
Hod took out his cell phone and dialed the number with a distrustful look.
“Youkeepdiggingpushingdrivinglikeahammerhittinginmyheadspace…”
Only after the phone on Wanda’s desk rang did he feel relieved and hung up the call.
Wanda was stunned at first, then asked angrily: “You still don’t believe me!”
“This is my first time after all, so I have to be cautious no matter what.”
Huo De proudly shook the phone in his hand.
“Where are my clothes?”
Wanda asked with a pout as she felt the friction on her chest.
She really didn’t want to stay here for a moment.
“The clothes have been cleaned and placed in the closet.”
“You want to leave now? Tony is at the door.”
The corner of Hood’s mouth turned up, and he glanced outside the door with a smile.
“I can go through the window!”
Wanda nodded at the window.
She didn’t want Tony to see her in this situation.
Now the entire team is at the center of public opinion.
It is obviously not fair for me to appear here and do such a thing.
“Okay, make sure the phone is open.”
Hood did not forget to remind Wanda again, and then stood there looking at Wanda motionlessly.
“Turn around!”
With just one glance, Wanda guessed what Hood was thinking.
“This is my home, and I remember it!”
Hodder tapped his temple lightly with his index finger.
Wanda gritted her teeth in anger. Every time she talked to Hood, she felt like she had met her nemesis.
She then waved her right hand, and the quilt was pulled in front of her like a curtain, and she quickly changed into the scarlet combat uniform.
Hood couldn’t help but smile as he watched Wanda cautiously jump down from the window like a thief.
“How come this is like committing a crime of thief?”
[Ding! You and Scarlet Witch Wanda have established a special relationship between man and woman! ][Get reward: God-level magic talent! ]……….
Chapter 7: Wanda needs to be rewarded (old version)
“Wanda is really my lucky star!”
Hear the reminder sound echoing in your mind.
Hodder was in high spirits.
The witch really has a lucky attribute. She gave herself two surprises in just one day.
Next time, I will definitely reward her handsomely.
God-level magic talent, as the name suggests, gives him an incredible understanding of magic.
In the future, learning magic will be smooth.
Ta-ta-ta…
There were hurried footsteps in the corridor.
“Hod!”
Tony Stark’s slightly tired voice came from outside the door: “Why haven’t you come out for so long? Are you having a tryst with a beauty in there?”
He waited outside for several minutes but didn’t see Hood coming down, so he just went up himself to urge him.
“yes.”
Huo De casually opened the door and took a deep breath with a smile on his face: “There is still the faint fragrance she left in this room!”
“You live a leisurely and comfortable life.”
Tony Stark, who used to be a playboy, couldn’t help but sigh when he saw Hood’s leisurely appearance.
He is indeed a super hero now, but the burden on his shoulders is much heavier than before.
Besides, now that I already have Little Pepper, there’s no point in even thinking about going out and fooling around.
“Okay, let’s go down and talk!”
Hood adjusted the belt of his bathrobe, patted Tony Stark on the shoulder, and walked downstairs first.
As Hod moved, Tony Stark glanced at the open door.
There was no one in the messy room, only a shirt scattered on the bed.
The floor-to-ceiling window not far away was open, and the curtains fluttered slightly in the breeze.
Tony Stark shook his head and didn’t care about it anymore. Instead, he followed Hood towards the reception room.
A sofa inlaid with gold edges is placed on a hand-woven classical pattern carpet, and the scent of incense wafts through the living room.
“Mr. Tony, do you want to drink a glass of wine or something else?”
Sitting on the soft and comfortable European-style sofa, Hood spread out his hands and asked lazily.
“liquor……”
Tony Stark hesitated for a moment and finally shook his head and said, “Give me a cup of tea!”
He had to stay awake now.
Hodder just gave the maid a look, and soon two cups of Earl Grey tea were placed on the marble table in front of the two men.
“I didn’t expect that the famous superhero Mr. Tony Stark would not sleep in the middle of the day and actually come to my place.”
After the maid left, Hood looked Tony Stark up and down with a teasing look.
Tony’s mental state has been much worse recently, and his eyes are filled with fatigue.
“Hodder, stop joking.”
Facing the teasing, Tony’s tired face forced out an ugly bitter smile: “I’m not in the mood to sleep now, let alone sleep until noon.”
In the past, he indeed slept until noon and might not even get up, but it was unknown how long ago that happened.
Now all that was left on his face were the deep dark circles under his eyes.
“Actually, I’ve heard about the incident in Germany, and I was just about to go look for you.”
Hood put down his crossed legs, his lazy expression became more serious at this moment, and he got straight to the point.
“Well, you know Ross, that damn old guy who was in the military before!”
At this point, Tony Stark gritted his teeth, picked up the teacup and drank it all, then said: “Now this damn guy is the Minister of National Martial Arts in the National Martial Arts Garden!”
“What does he want to do?”
Hood nodded in agreement. He didn’t have a very good impression of this guy.
“If this current situation cannot be resolved, the Avengers will be directly controlled by the government!”
Tony Stark put down his teacup, rubbed his brows and sighed.
He is now caught in the middle, and no matter which side he chooses, he feels extremely embarrassed.
“hehe!”
Hodder sneered disdainfully: “Do they really care about this? These ruthless politicians are just looking for an excuse to control the Avengers!”
Every one of these guys is acting for their own selfish gain.
And he was also very clear that in this incident, Wanda was the biggest victim in public opinion.
Tony Stark behind the scenes is undoubtedly the person under the most pressure because this incident was caused by him.
He needs to be responsible for the entire Avengers and clean up the consequences and impact of this incident.
Moreover, Lord Wu of Ross had already had this intention a long time ago, intending to have the Avengers managed by the government.
Although Tony Stark did not object to this decision, Steve Rogers and others did not want to do so.
This also makes Tony Stark very embarrassed.
Chapter 8 Lucky Star Wanda (Old Version)
“I also know that those guys are just eyeing this piece of Avenger meat.”
Tony Stark already knew this a long time ago, and the German incident was just an excuse.
The higher-ups have been thinking about how to control the Avengers.
After all, before this, although the Avengers were the official organization of the organization, they would not obey orders from anyone.
All plans and implementation plans are formulated internally by the Avengers.
This obviously makes them unhappy, and they may even feel that the Avengers are getting out of control.
For the guys above, the uncontrollable power is simply unbearable for them.
What happened this time just gave them an opportunity to take advantage of the situation.
“So what is your trip?”
Hood picked up the teacup and took a sip, then looked at Tony Stark with a puzzled look.
“Brother, I came to you first to vent my complaints, and secondly to ask if you have any solution.”
Tony Stark looked helpless.
He knew that Hood was much smarter than ordinary people, so he came to ask for Hood’s opinion.
There might be unexpected surprises.
“public opinion.”
Hodder paused and explained: “The main contradiction this time is the pressure of public opinion.”
“If we can change people’s views on the Avengers, everything will be much easier!”
“You should also know that the current trend of public opinion is not favorable to you!”
After all, if the people above hadn’t hinted at it, this incident would definitely not have caused such a big impact.
“But…it’s not that easy.”
Tony Stark looked bitter: “It’s hard to change the direction of the wind now.”
In fact, it’s not that he doesn’t know this, but it’s difficult to make changes.
Hodder leaned forward, tapping his fingers on the table. “In fact, the main point of public opinion is Wanda.”
The mistake in the Crossbones explosion caused the long-suppressed public anger to explode in an instant.
If public anger is likened to a powder keg, then public opinion is the chain of fire that ignites the powder keg.
“You mean… changing Wanda’s public image?”
“But Wanda is very emotionally unstable right now. Last night…it seems like she didn’t return to the base. I’m a little worried that she can’t handle the pressure.”
Tony Stark looked thoughtful and expressed his inner thoughts.
Cough cough cough…
Hodder was drinking Earl Grey tea and he choked and coughed when he heard this.
He looked at Tony with a complicated expression and thought to himself: She definitely didn’t reply. I played poker with her all night last night.
“Are you okay?”
Tony noticed the surprise on his friend’s face.
“fine.”
Hodder wiped the water stain with a tissue and said, “As long as you can get the people to support Wanda again, this problem will be solved!”
“Well, but…”
“Wanda can’t fully control her abilities. I’m worried that she’ll make mistakes again when she goes on a mission, and this incident will have a huge impact on her!”
“Maybe, she just needs some time and a little help.”
Tony Stark had never seen Wanda so lost. Even during this period, whenever he saw Wanda, she looked depressed.
No matter how much guidance is given, there is not much effect.
Hodder seemed to be thinking deeply after hearing this.
That is, maybe I can help Wanda.
Although we just met by chance yesterday and some misunderstandings occurred.
But no matter what, he obtained the “fragments of the Phoenix Force” and “god-level magical talent” from Wanda.
What’s more, there are many more treasures in Wanda that are worth digging deeper.
Buzz~
At this moment, the watch on Tony Stark’s wrist flashed blue twice.
He raised his hand and took a look, with a hint of melancholy in his eyes.
“Hodder, thank you for listening to my complaints!”
“Steve has been a bit emotional lately and isn’t even willing to sit down and talk.”
“I have some shit to deal with right now, let’s talk another day!”
After saying.
Tony Stark sighed and stood up to say goodbye.
Although Hood did not give any specific plan.
But after saying this, Tony Stark’s mood calmed down a lot.
When people are under too much pressure, they basically just need someone to listen to them.
And Hodder has always been his most loyal listener.
“Okay! You’re welcome to come visit us when you’re free!”
Hood also stood up and saw Tony off before returning to the room.
“System! Open the panel!”
After sitting in the chair, Hood had a thought, and the system’s virtual panel appeared in front of him.
[God-level Magic Talent]: Allows you to possess an incredible understanding of magic without having to borrow magic power from the dimensional demon!
This simple introduction was enough to make Hood excited.
“Wanda, you are really a little lucky star!”
It’s definitely another god-level reward!!!
Chapter 9 Top Magic Talent, Learn Magic at Your Fingertips! (Old Version)
God-level magic talent is extremely important to Hood.
Phoenix force, chaos magic, and fairy power are three ancient energy bodies.
They are familiar with each other, and they are both the best energy bodies for practicing magic.
Possessing even a small fragment of one of them would give you extremely powerful power.
Now with the blessing of god-level magical talent, he will make rapid progress in cultivation.
Hod now has god-level magical talent plus the power of the phoenix.
It is simply a holy body of magic practice. Even Ned Leeds’s talent cannot compare to it.
The most terrifying thing is that he doesn’t even need to draw power from demons in other dimensions.
Magic in the Marvel Universe is not created out of thin air, but draws power from demons from other dimensions.
And this requires a corresponding price!
Only mages and the sworn brothers of Kamar-Taj are allowed to borrow magic power from the dimensional demon Vishanti.
It’s just that the cost of borrowing magic power from Emperor Wei Sandi is very small, so it is white magic.
If it is black magic, it will require a heavy price, even the soul.
But Hood doesn’t have to pay any price!
“Wait! That’s not right!”
Just as Hood was excited, the smile on his face suddenly stopped.
Because I remembered the most important thing.
“It’s useless even if I have god-level magic talent! I don’t even have a magic book…”
This is equivalent to having a gun but no ammunition.
Although when he was playing with Wanda, he was able to use his magic to deal with Wanda’s chaos magic.
But this is just crushing it directly with the power of the Phoenix.
Although it is possible to mobilize, it is purely the use of energy.
“It seems we have to think of a way!”
Huo De sat cross-legged in the chair, thinking quietly in his heart.
“If I remember correctly, the Saint of Earth seems to be in New York!”
If I remember correctly, one of the temples of Kamar-Taj is in Manhattan, New York.
According to the timeline, the future Sorcerer Supreme, Doctor Strange, is also on the Holy Earth!
There must be the magic book you need in the Holy Land of Earth!
The Holy Earth Temple is one of the important temples.
In the Marvel world, it is Doctor Strange’s main residence and base.
A center dedicated to Doctor Strange and his team for magical learning, research, and protection of the Earth.
Its greatest function is to provide a safe place for Doctor Strange and other guardians to train and store knowledge.
To protect the world from the forces of evil.
“But how to get in is a problem…”
Hodder stroked his stubble and pondered secretly in his heart.
If I remember correctly, there is a part inside the Holy Earth that is open to the public!
You can buy a ticket and join a guided tour to enter the temple.
Although Kamar-Taj does not involve itself in worldly affairs, it still needs to make money.
Maybe this will give you a chance to get access to those magic books.
afternoon.
Outside a building in Manhattan that exudes an ancient atmosphere.
“Everyone, slow down, don’t be in a hurry, line up and follow me in one by one!”
The fat man in the lead was waving a small red flag in his hand. He forced a smile on his honest face and led a group of people inside.
He looked like a tour guide, but the clothes he wore were of a very simple style.
At first glance, it looks like the clothes of monks in the past.
Although it seems a bit out of tune with modern society.
But when I saw the plaque next to the door saying Welcome to the Magic Library, everything seemed to make sense.
“So professional, even their work clothes look so immersive!”
The little girl held her mother’s hand, widened her eyes and sighed.
Everything that appeared around them amazed the tourists who came here to visit.
This kind of ancient building was something they had never seen before.
“king……”
At the end of the team, Hood, wearing a casual black sportswear, looked at the fat man leading the way in front.
He really didn’t expect that the archmage who managed the Kamar-Taj Library would have to come out in person to receive guests.
This makes me sigh at the impermanence of the world.
The king led everyone into the temple.
An ancient and long-standing atmosphere blows in the face.
What catches your eye is the ancient European style, with a magnificent ceiling above the hall.
Around the library, there were many apprentices in monk robes cleaning.
“Everyone!”
Wang stopped and turned to the tourists and said, “You can read the books on the first floor, but be careful not to damage them, otherwise you will have to pay for it!”
“Can this magic book be read directly to people?”
Hod looked around in surprise, feeling somewhat confused.
But it only took him a moment to realize why he did that.
Putting aside other things, even a genius like Doctor Strange needs to receive guidance from the Grand Master before he can understand it.
Not to mention a group of ordinary people who have no talent for cultivation.
And from the current performance, it can be seen that the magic books placed on the first floor are not that important.
I guess it won’t have any impact even if it is copied by outsiders.
Otherwise, Wang would not have said that the damage only required compensation.
Most of the tourists who come here are magic fans.
After getting permission, the tourists dispersed and began to browse the magic books on the bookshelf.
They were very curious about these books used to learn magic.
But most people just took a quick look at the books after opening them.
They couldn’t understand the content at all, so they just put it back.
Hood followed the others and came to the bookshelf, stopped, and pulled out a magic book to look at it.
On the side, Wang stopped and watched quietly.
When he saw the confused looks on everyone’s faces, he couldn’t help but shake his head in disappointment and let out a helpless sigh.
There are indeed very few people in this world who can master magic and be sensitive to magic.
“What’s with that expression on your face? Do you really expect a group of children and a bunch of middle school students to be able to understand ancient books?”
Just as Wang was sighing, a voice suddenly came from beside him.
The sudden sound made Wang tremble violently, and the flesh on his cheeks couldn’t help but move slightly.
He turned his head and saw a person in a red cloak standing silently behind him.
The man was tall and thin, looked to be in his thirties, with a slightly yellowish beard on his cheeks.
He has a typical British look, and even his every move is elegant.
“Stephen, you walk without making any sound?!”
Wang couldn’t help but complain that he didn’t even notice Stephen Strange appeared behind him.
“I’ll come and take a look.”
Doctor Strange Stephen Strange glanced at the crowd coldly and said arrogantly: “Even I can’t teach myself, let alone them.”
His talent gave him reason to be proud of himself. After all, he was Ancient One’s most promising disciple.
In his opinion, the king’s actions were just a waste of time.
When I first started learning magic, I made rapid progress, but this was only possible with a guide.
Even if these ordinary people have some magical talent, it is impossible for them to learn on their own without the guidance of a leader.
“I’m just trying to discover some talent.”
Wang shrugged and spread his hands helplessly.
Although the possibility is very low, who can say for sure?
“Don’t waste your time. Use this time to buy me a sandwich later. That money…”
As Stephen spoke, he fumbled in his pockets, paused, and said with a straight face, “Wait until those guys pay for the sightseeing fee, then you can just deduct it!”
Wang was about to say something when a strange noise suddenly came from the surroundings.
Suddenly, a violent buzzing sound resounded throughout the temple.
“Wow! Oh my God, what is going on!”
“Look, there is actually magic in this world!”
“Mom, this is really amazing! I want to learn it too!”
The tourists who were reading books around were amazed by the scene before them and exclaimed in amazement.
This was the first time they had seen such a scene in real life.
“What’s going on?”
Stephen frowned and looked towards the direction of the sound.
But when he saw the scene that appeared, his blue pupils contracted sharply.
I saw a dazzling and ancient golden light, like a meteor flying in the night sky, unfolding a circular portal in the air.
Standing in front of this golden light was actually a young man with an indifferent expression.
That was actually the gate to dimension!
What made their hearts beat faster was…
He actually opened the dimensional door with his bare hands!
I didn’t borrow the power of the hanging ring!!!
Chapter 10 Shattering Doctor Strange’s Three Views, Such a Terrifying Talent! (Old Version)
“What’s going on! Why did a dimensional gate appear?!”
Stephen stared at everything that was happening in front of him, his pupils were trembling constantly, and all his attention was focused on the young man’s hands.
Because he clearly saw that there was no ring on the young man’s hand!
He actually opened the latitude gate with his bare hands? !
Is this world really crazy?!
“Wang, tell me if this is a dream or not!”
He now doubted whether he had not woken up yet!
You know, the hanging ring is the key to helping mages concentrate their magic power.
Without the hanging ring, it is almost impossible to control magic!
Unless one has a very high understanding of magic, and also has a natural affinity for magic!
But……
This is just in theory, how could there be such a person in the world!
This is simply a magical holy body!
Wang spoke after a long while: “You are not dreaming!”
He had just hit his thigh hard.
I didn’t expect that a magical genius would actually appear!
The king’s eyes almost popped out of his head, and he knew very well that he was just killing time.
That’s why every time I take people sightseeing, I check to see if anyone has magical talent.
But he really didn’t expect that a magical genius would appear at this time.
When seeing this scene.
His mind was almost blank, and he didn’t come back to his senses for a long time.
The tourists around the temple looked at the dazzling scene with their eyes almost glowing with gold.
“This is so beautiful. I didn’t expect someone would actually cast magic!”
“I remember he seemed to come in with us. He was also one of the tourists!”
“I originally thought these books were fake, but I didn’t expect that someone actually learned magic!”
“This shouldn’t be the case. If this were the case, I should have used magic just now!”
Originally, most people came to the Magic Library for entertainment.
Although there are magic books, they don’t take them too seriously.
But they didn’t expect that someone among their group of tourists had actually learned magic.
This made them all unable to help but follow Hood’s actions and start trying.
But this is the only way to be able to cast magic in this situation.
“I didn’t expect it to be successful on the first try.”
Hod looked at the open dimensional door in front of him, the corners of his mouth twitched slightly and he muttered to himself subconsciously.
Just now he casually took out an ancient magic book, which happened to record the spell of the dimensional gate.
I originally thought that I would need the help of the hanging ring to open the door to the dimension in order to cast magic.
After reading it roughly, I started trying it according to the above content.
He just imagined the opening position, then gently drew a circle with his right hand, and the golden light appeared instantly.
He didn’t expect it to be so easy to open.
However, I had a vague guess that it was probably because I had magical abilities in my body.
Coupled with this god-level magical talent, it can be achieved so easily.
“The first time?!”
Although Hood muttered in a low voice, his words still reached Stephen and Wang’s ears.
After hearing these words, Stephen, who seemed calm, almost fell to his knees.
“You told me this the first time and it worked?!”
Stephen clearly remembered that he was under the guidance of Master Gu Yi.
I practiced day and night, and I don’t know how much time and energy I spent to practice opening the dimensional door.
In order to achieve this, he has been enduring the double pressure of mental and physical oppression.
But even so, it didn’t succeed!
After being sent to the snowy mountains and forced into a desperate situation, he opened the door to the dimension.
The words of the young man in front of him were like a steel knife, forcing him, who was usually calm, to doubt his life.
One time pass?!
How dare he say such a thing!
This is simply the most terrifying monster in the world!
“Incredible, is this a true genius?”
Wang’s Adam’s apple rolled up and down, and he looked at Stephen beside him with a strange look.
Previously, Ancient One said that Stephen Strange was a wizard with extraordinary talent that only appears once in a century.
Under his guidance, Stephen Strange indeed showed great talent.
But compared with the young man in front of him, this is not on the same level at all.
For a moment, he even doubted whether he had brought back the wrong person.
The person that the Supreme Sorcerer was talking about should be the young man in front of him.
“This is simply a monster!”
The king has lived for hundreds of years, and this is the first time he has seen such a scene.
This is more than just shocking.
To use a more popular term nowadays, it’s an explosion!
“Who on earth is this guy?”
Stephen took a deep breath, his voice trembling slightly.
His brain was working rapidly, but he couldn’t think of any background of the young man in front of him.
If this is really the first time, it is estimated that Master Ancient One will need to change the position of successor to the Sorcerer Supreme to the young man in front of him.
Just as they were exclaiming in amazement, Hood suddenly had an idea and stopped what he was doing.
The dimensional gate that was shining with golden light also slowly disappeared.
“I remember it was like this…”
Hood frowned, recalling the words in the magic book.
He stretched out his hands and waved them violently.
The temperature inside the temple also dropped rapidly at this time.
“Blizzard!”
Huo De took a deep breath and recited to himself.
An oversized circular golden magic circle appeared above the library.
As the golden light flickered, the dazzling light filled the entire library.
Everyone’s eyes widened.
Phew~
And the next second, snowflakes suddenly fell from the sky.
As the snowflakes fell, it turned into a blizzard in an instant.
The blizzard, accompanied by strong winds, instantly blew the scattered papers and books in the library into all directions.
The air exhaled by the tourists who were originally watching turned into mist in an instant.
The fierce gale forced them to bend down and try their best to resist the gale.
In just a moment, the temperature in the room dropped sharply to minus 3 degrees Celsius.
In just a blink of an eye, the entire library was covered in heavy snow.
Everywhere I looked, it was all white.
Chapter 11 Learning magic at night, deep communication of love! (Old version)
Snowflakes were flying everywhere in the hall. The heavy snow lasted only ten seconds and the thick snowflakes were already above the knees.
The cold was like a maggot in the tarsal bones, turning everyone’s face pale.
They looked up at this almost miraculous scene, and frost had already formed on their eyelashes.
A biting chill ran down their throats.
“Is this magic? Isn’t this the same as God?”
“The combination of beauty and coldness actually appears in this library!”
“Mom, I’m so cold, but this is so beautiful!”
“If I go back and tell my classmates, they will definitely go crazy with jealousy!”
Although the cold made them shiver, the tourists at the scene did not leave.
This is a scene that will be unforgettable for everyone for the rest of their lives.
I don’t know whose flash suddenly flashed at this moment.
The dazzling flash made everyone react instantly at this moment.
They took out their cell phones and cameras hanging on their chests.
I kept pressing the shutter button with trembling hands.
“Hey! Look over here!”
At this moment, a magnetic and deep voice attracted everyone’s attention.
The levitation cloak carried Stephen into the air.
He stretched out his right hand and snapped his fingers.
White light suddenly burst out from the fingertips, and the dazzling white light illuminated the library.
The tourists who saw this scene closed their eyes and collapsed into the snow.
At this time, the only ones still standing were Hood and the people from the temple.
“What are you doing? Are you going to kill someone to silence them?”
Hood, who was admiring his masterpiece, saw the tourists lying on the ground, and turned to look at Stephen Strand floating in the air.
“Don’t worry, it’s just a little sleeping spell.”
Stephen looked down at Hood who was standing in the middle of the library and said, “Let them have a good sleep and just treat it as a dream!”
“I thought you were jealous of my talent and wanted to kill me to silence me.”
Hodder teased calmly.
He naturally knew what kind of person Stephen was, so he was not afraid at all.
“I’m jealous of you?”
Stephen’s face darkened instantly after being touched. He gritted his teeth and said, “These are all the things I left over. Young man, you are still far from it!”
“Alright! Stop pretending Stephen!”
Wang interrupted Stephen impatiently and looked at Hord warily: “Who are you!”
Although this young man is extremely talented, Wang will never take it lightly before he gets to know him better.
“I?”
With his back to the two of them, Hodder casually put the magic book in his hand back on the bookshelf and said calmly: “Hodder, an ordinary person!”
[Ding! You have learned the first magic in your life! ][Reward: Xithorn Scroll (Incomplete)]Um?
The Scroll of Sithorne?
Isn’t that the predecessor of the Dark Book?
Hood didn’t expect that he would receive this reward.
“Ordinary people?”
Wang snorted coldly and continued, “A wealthy businessman? A businessman? A mountain climber? Or a champion in a shooting competition?”
“As expected of a great wizard prophet, you actually knew my identity so quickly…”
Hod said as he turned back to look at the king.
But when he saw the king, his voice stopped abruptly.
Because Wang Zheng was holding a touch-screen phone and reading the information on the web page seriously.
No. Is it really okay for a mage to use such a simple and unpretentious method?
Wang raised his head and saw Huo De’s surprised look and smiled: “I think I saw you in the newspaper before.”
“Yes, there was…”
Huo De watched Wang put the phone back into his arms, then he calmed down and nodded slowly.
After obtaining the system, I wanted to get more surprise rewards.
So I have experienced many exciting projects once, and I am tired of wing suit flying.
Stephen, who was standing by, listened to the conversation between the two and the corners of his mouth twitched slightly.
He felt sick after hearing so many titles.
I can’t win in terms of talent, and my previous life experiences are completely not on the same level!
“Ahem…”
Stephen clenched his fist, put it in front of his mouth, coughed twice, and slowly dropped it to the ground: “You are very good, but magic is not as easy as you think.”
Wang could tell at a glance that Stephen was about to show off again, so he simply stepped aside in silence.
“Is it difficult?”
Hood looked at Stephen not far away with a smile.
Facing Hord’s ridicule, Stephen Stellan said calmly with his hands behind his back: “Well, if you want to be an excellent wizard, you must have an excellent guide!”
After saying that, he waved his right hand casually.
A light breeze blew up out of nowhere, carrying the snow in the library upwards.
At first glance, it looks like a silvery-white veil is floating around the library.
When the snow was blown up, it slowly disappeared with the breeze.
In just a blink of an eye, the snow that had just covered the library had disappeared.
After doing all this, Stephen Strand slowly put his hands behind his back again, and even raised his chin slightly.
I have to say, this operation is really amazing.
But Hood just nodded slowly and uttered one word: “Oh.”
But what is worthy of his admiration is that Stephen is worthy of being the successor of the Supreme Sorcerer and he really has some skills.
“Do you want me to be your guide?”
Stephen Strand almost couldn’t hold back when he heard this indifferent response.
no.
I’m pretending to be such a big shot, and you just say one?
“No, I have something to do so I’m leaving now!”
Hod shook his head, having just obtained a scroll of Sithorne.
He now has to go back and study it carefully, as that thing is of the same level as the Book of Vishanti of the Supreme Sorcerer.
“ah?!”
Stephen felt terrible when he heard this.
This was completely different from what he had expected. Shouldn’t he come up and beg for instruction at this time?
And at this time, Hood actually turned around and walked towards the door.
“Don’t go!”
Stephen said in a hurried tone: “You really don’t want to become my disciple and become a mage?”
This is a rare genius!
It would be a shame if I left now!
“In no mood!”
Huo De shook his head without hesitation and said, “Don’t worry, I won’t tell anyone what happened today.”
Unless he was crazy, he would not follow these people to suffer in the snowy mountains.
Instead of spending this time, you might as well go find your baby Wanda and have some in-depth loving exchanges.
When Stephen saw that Hood was about to leave, he was about to step forward but was stopped by Wang.
“Mr. Hodder, if you want to learn magic in the future, you can come over anytime!”
Hearing this, Hood paused, nodded seriously, and then left.
.
….
After Hood left, Stephen Strand was still in a daze for a long time.
“Stephen, it seems that you are still not attractive enough!”
Wang held back his laughter and spoke teasingly in a teasing tone.
“What does this have to do with my attractiveness! It’s that he doesn’t want to learn magic!”
Stephen Strand stiffened his neck and refused to admit it no matter what.
He is a top genius, so how could he refuse this idea?
“He learned it by accident, just by looking at it.”
Wang looked up at the scenery outside the window, feeling the chill in the air and sighed: “We may have encountered a genius. We must tell the Supreme Mage quickly!”
“No one can hide from Master Ancient One.”
Stephen smiled and shook his head and continued: “Maybe she already knows…”
…………….Dividing line………………..
Chapter 12 Contact Wanda, come to my house tonight, Sithorn’s scroll! (Old version)
Inside the Cayenne modified with a starry sky roof.
Huo De unfolded a Yang Ping scroll, which was filled with all kinds of strange ancient texts.
“Is this the Scroll of Sithon?”
He frowned slightly and looked carefully at the ancient text above.
The Scroll of Sithon was fabricated by the ancient god Sithon.
In fact, it is the predecessor of the Dark Book.
It records in detail the most terrifying black magic in the world.
And its influence is so great that anyone who has ever read it will be corrupted by it.
Losing their souls is possessed by Sithon.
It was once the source of the Necronomicon, the Book of the Damned.
If the “Book of Emperor Vishan” practiced by the Supreme Sorcerer is the Nine Yang Divine Art.
Then the Xithorn Scroll is the Nine Yin Scriptures.
The two books contain completely opposite and opposing techniques.
Therefore, those who practice Xithorn’s magic will be corrupted and even their minds will become dark and twisted.
However, Hood doesn’t have to worry about this problem at all. He can obtain the Scroll of Sithorn without absorbing Sithorn’s power.
Therefore, Sithorn had no way to exert any influence on Hood.
“If I remember correctly, there are some contents here that can help Wanda stabilize her ability…”
Hod took a quick look at the Xithorn Scroll and thought to himself.
In the original movie, Wanda once used the Scroll of Sithon to practice chaos magic.
As long as you practice a part of it, you won’t be affected by too many attacks.
“It seems that we still have to find a way to help Wanda through the Seathorn Scroll.”
Hod put the Sithorn Scroll back into the system and thought to himself.
The ability to control is very important to Wanda now.
Because in the German incident, the reason for the failure of the operation was partly because Wanda had little control over her own abilities.
With Scarlet Witch’s true strength, controlling the explosion is not a problem at all!
“Why not… pick up Wanda now?”
When Hodder thought of Wanda’s appearance, the corners of his mouth rose with pride.
I guess Wanda’s expression will be very interesting when she sees me.
I have to admit, he has a bad taste sometimes.
He took out his cell phone and dialed Wanda’s number without hesitation.
…
Avengers Base, inside Wanda’s room.
Wanda curled up in the quilt, the scenes of last night flashing through her mind.
“w(?Д?)w!”
Although she said she always wanted to forget, the pain in her body kept reminding her again and again.
“That damn Hod didn’t even introduce himself!”
If the maid hadn’t called out Hood’s name, Wanda would have had no idea who this man was.
And for some reason, an indescribable feeling has been lingering in her heart.
Buzz buzz buzz
The cell phone, which was turned to silent mode, kept vibrating on the bed.
“Hello? Who is this?”
Wanda answered the phone with a tired tone.
“My lovely little witch, have you forgotten me so quickly?”
When Hood’s voice came from the other end, Wanda almost jumped up.
She never expected that Hood would call her so soon.
“Why…why are you calling me?!”
Wanda’s voice was stuttering.
“What do you think?”
There was a hint of teasing in Hodder’s voice.
Wanda was stunned for a moment, and her face turned red after a moment: “You… called here just to act like a hooligan?!”
“I was just thinking about my witch.”
Hodder’s deep and distinctive voice came.
“Who… is your witch? Don’t talk nonsense!”
What Hood said just now made Wanda’s heart beat faster.
It has to be said that Hood indeed occupies a very important position in her heart.
No matter which girl you are, it is impossible for you to forget this experience.
“oh?”
Hod lowered his seat, his mouth curled up: “So you mean you are irresponsible? Then I will tell Mr. Tony Stark!”
Listening to Wanda’s angry voice like a kitten, I could imagine what she looked like.
“What on earth are you going to do?”
Wanda heard the sneer coming from Hood and asked in a vigilant tone.
“I just want to talk to you about our previous relationship.”
When Hood spoke, his voice was deliberately prolonged.
“That’s what you want…you animal with a brain full of dirt!”
Wanda could now imagine Hood’s gangster-like smirk.
This made her clench the cup tightly in anger.
“Where the hell are you?”
Hodder asked further.
“alright!”
Wanda gritted her teeth and said, “Go to the back door of the base! I’ll wait for you there!”
The two white-looking buildings are connected by an aerial corridor, and there are two large helipads in the base.
Looking down from above, it looks like a connected V.
And this is the Avengers Base, sponsored and built by Stark Group.
“Memarchosinsabersimebesasteantesdeirte!”
“Tedimicoraz?3nyt?oloregalaste!”
“Teditodoelamorquepudedarteymerobaste!”
Hod drove the Cayenne on the way to the Avengers base, swaying slightly to the rhythm.
At this moment, a group of people holding signs were seen in the middle of the road ahead from afar.
“Superheroes get out of New York!”
“We don’t need these hypocritical violent lunatics!”
“Wanda, get out of this city. She is an absolute devil!”
“It’s just that they are using the name of justice to hurt everyone at will!”
These people held signs and shouted as they protested in the direction of the Avengers base.
“this……”
Hodder was speechless for a moment when looking at this scene. He had to say that the people here were really simple and honest.
Not to mention Wanda, even he would get a headache if he saw this scene every day.
And these poor people are just blinded by the media.
Both sides are just victims, and the real beneficiaries are just the top executives.
This is the truth of this world. Only by creating conflicts can their interests be protected.
“Ah…poor Wanda…”
Hodder turned down the volume of the music, and his joyful mood became slightly lost at this moment.
He is just a poor man, yet he has to endure such injustice.
strength?
Despite her powers, she is as fragile as an ordinary person.
Just at this moment.
Hodder’s phone vibrated slightly.
[Wanda]: “I’m at the back door.”
After seeing the above information, Hood drove the car directly into a small road.
But after just a few steps, a figure rushed out from the woods.
Crunch!!!
At this critical moment, Hood stepped on the brakes to the bottom.
He raised his head and looked ahead with a frown.
No, the charm of this Cayenne appears in the grove, right?
Just then, several other people rushed out of the woods.
Among these people were men and women, with white paint on their faces.
He got in and without saying a word, he started banging on the car windows and hood frantically, baring his teeth at the window.
“Fuck? Are you planning to rescue me with nano-power?!”
Hood was bewildered as he watched this scene. He had no idea what these lunatics were doing here.
Even a zombie crisis wouldn’t be that morbid!
“Get out here, you bastard! You’re in league with the Avengers!”
“I saw it, you must be planning to enter the Avengers base from the back!”
“Get that damn bitch Wanda out here right now! Otherwise you’re dead!”
“Don’t think you can get away with it, you murderous demon!”
Looking at these crazy people, Hood clenched his teeth, and veins gradually appeared on his forehead.
“You are really looking for death!”
In his opinion, these guys only work so hard because they are paid.
It is obvious that the people above are deliberately stirring up trouble, intending to use this method to force the Avengers to compromise.
He unbuckled his seat belt and rolled up his sleeves.
Just then, the phone suddenly vibrated.
【Wanda】: Ignore them, go back.
Hodder looked at the message, well aware that Wanda was watching him.
After tapping a few times quickly on the phone screen, he sent the message.
[Hodder]: They should suffer a little!
The Avengers couldn’t take action for the sake of justice, but he was different.
He’s not a member of the Avengers?
justice?
Moral kidnapping?
As long as there is no morality, no one can kidnap.
Hodder simply opened the car door and walked down.
That burly figure brought a strong sense of oppression to these people at this moment.
“I’m out, you guys come on!”
Hood stared at these so-called protesters with a cold expression.
Faced with the pressure brought by Hood, the protesters unconsciously took a few steps back.
They really didn’t think that Hood would actually get off the car.
“Fake! He’s all alone, what is he afraid of!”
“Teach this ignorant fellow a lesson!”
“This guy is not a superhero, get started! Attack together!”
Several protesters gritted their teeth, raised their signs and threw them at Hood.
call!
However, as the wooden sign flew through the air, a dark light suddenly flashed in their eyes.
He suddenly stopped the wooden sign in his hand and then smashed it at his companion.
“Fake! Are you blind?”
“Ah! Don’t hit me! Have you taken too much?”
“Who brought this guy in?!”
The protesters fought each other at this time.
It was like the most primitive wild beasts, biting and struggling with each other non-stop.
“tui!”
Hood’s pupils flashed with a fiery red light, looking strange and bewitching.
He shook his head contemptuously and got in the car and left.
Chapter 13: Intermingling with Wanda, this is Chaos Magic! (Old Version)
The Cayenne slowly drove into the path and stopped at the rear gate of the base.
Hood looked around and saw a woman wearing a baseball cap and a hood walking out cautiously from behind a tree.
Wanda did not wear her iconic red windbreaker today.
The eyes between the hair were filled with melancholy and pain.
Hood could tell from her expression that she was not afraid of herself, but of the protesters.
Just like the situation just now, that group of crazy guys wanted to tear Wanda apart alive.
After making sure that the protesters in the distance were still fighting each other, Wanda trotted to the passenger seat of the car.
After getting on the bus.
The tense expression on Wanda’s face relaxed a lot and she breathed a long sigh of relief.
She would rather face Hood than the protesters.
Whenever she saw the distorted faces of the protesters, she felt mixed emotions.
“It’s okay, they didn’t see you!”
Looking at Wanda like this, Hod couldn’t help but comfort her.
“Although you are not a good person, I still want to thank you.”
Because at this moment, Hood still chose to stand on her side.
Even though his words were a little irritating, he was always concerned about her.
No matter from the beginning or to the end, I chose myself without hesitation.
She had just been planning to get out of the car and vent her anger, which made her feel a little warmer inside.
Hodder is the only person besides the Avengers who cares about him.
Even when I was drunk, I still wanted to help myself first.
Even though there is a lot of criticism coming from outside, I am not shaken at all.
The corners of Huo De’s mouth slightly raised, and he asked with a smirk: “Am I not a good person?”
“Stop pretending. You came to me just for that matter!”
Wanda pursed her lips and glanced at Hood unhappily.
These are what men think about.
Besides this matter, how could Hood have anything else to ask her?
“Little witch, you are too dirty. Who is the same as you?”
“Have you ever heard the saying, how you see others is how others see you!”
Hod reached out and rubbed Wanda’s little head vigorously, then said, “I have something serious to talk to you about!”
“What business?”
Wanda turned her head and looked at Hood with a puzzled look.
“I called you out to teach you how to master chaos magic!”
Hood did not hide anything and directly stated the purpose of his trip.
“Chaos magic?”
There was a hint of confusion in Wanda’s eyes. It was the first time she heard this word.
“It’s your ability!”
Only then did Hood suddenly remember that Wanda didn’t know what the energy in her body was called.
“Chaos magic? My ability?”
Wanda was surprised and asked blankly: “Can you teach me how to control my ability?”
She has been trying to control this ability, but she has no way.
“Not sure yet!”
Hod glanced at Wanda, who was dressed tightly, with a wicked smile: “But you seemed to want to do something else just now!”
Wanda’s cheeks turned slightly red when she heard this.
Wasn’t what Hood said just now saying that her mind was not pure?
She glanced at Hodder’s expression cautiously.
In fact, she didn’t hate this man that much, it’s just that the pace of progress was a little too fast.
Hod suddenly pulled Wanda closer and rubbed her head: “I won’t tease you anymore, let’s go to my place first!”
After saying that, he started the car, turned it around and drove towards the manor.
He originally wanted to tell Tony that he could help Wanda stabilize her abilities, but it was not appropriate now.
After all, he couldn’t be sure whether he was really successful, so he could only try it with the idea of giving it a try.
Manor, a room decorated in a low-key and luxurious style.
Wanda sat on the white bed with her head lowered, looking restless.
From when she was in the car just now, she couldn’t help but recall what happened last night.
As her memory became clearer, it became harder for her to forget, and she could even recall every detail.
Plus, she was still in Hood’s room, which made her heart beat faster.
In the silent room, she could even hear her own heartbeat.
Hood picked up a stool and sat opposite Wanda.
With every move, Wanda could even smell the scent of cologne on Hood.
“Wanda, before we start, I want to ask a question!”
Hood sat upright, looking directly into Wanda’s blue pupils with a serious expression.
“you say……”
Wanda, who was originally a little nervous, was actually a little uncomfortable seeing Hood’s serious look.
“What do you think your abilities are?”
Hod paused, then asked, “Is it a mutated ability? Or is it an energy body, or has it brought some changes to you?”
Wanda pondered for a moment: “I… think it is an energy body. Back in the laboratory, Hydra injected a kind of energy into my body.”
“The energy bodies in my body can be mobilized at will. They will continue to regenerate and even change my body imperceptibly!”
“But they are hard to control and can even affect my mood!”
If she could really control the power in her body at will, she wouldn’t feel so powerless.
“Chaos magic does affect the mind, but it is not simply an energy body. It is an ancient form of magic.”
Hod explained chaos magic as simply as possible.
Wanda cannot control chaos magic, this power itself cannot be fully controlled.
If you want to control it, you can only continuously improve your control during practice, so as to further suppress the risk of losing control.
If she doesn’t do that, then what awaits Wanda in the end is only a critical point at some point.
Or when their emotions are out of control, they may be eroded by chaos magic and even turn evil.
He remembered that this was reflected in the later Scarlet Witch, who was eroded by chaos magic.
Eventually he turns evil and becomes a villain.
“You mean it’s magic inside me?!”
Wanda frowned and asked in a tone of disbelief.
Because in her opinion, this is just an energy body and should not have much to do with magic.
Besides, magic sounds too magical.
Hod didn’t say anything, but nodded with a firm expression, and at the same time stretched out his hands and held Wanda’s hands.
The sudden movement made Wanda’s heart beat faster and even her body became stiff.
“what are you up to?!”
Her face flushed, her heart beat fast, and even her body trembled slightly.
What happened yesterday is not over yet.
“Don’t be nervous, relax and cooperate with me!”
Hod looked at Wanda with a gentle look.
The gentle look made Wanda believe Hood involuntarily.
Hodder took a deep breath, and fire appeared in his eyes.
The next moment.
Fiery red energy material emerged from his palms.
After this energy substance appeared, the chaos magic in Wanda’s body was also awakened at this time.
Without any control, it actually emerged from her palm.
Chaos magic and phoenix power are intertwined and blended at this moment.
It was as if two plants were climbing up the ivy entwined with each other, and a mysterious feeling filled Wanda’s heart.
Wanda widened her eyes and looked at Hood in front of her with disbelief.
Because when the energy in her body blended with the fire, she felt an extremely strong sense of intimacy in her heart.
And she didn’t know why, but at this moment, she actually had a feeling that was hard to describe.
This was completely different from family and friendship, as if she could completely trust Hood.
Even the vigilant gaze became incomparably gentle at this moment.
She looked at Hood’s handsome face. It was clearly an oriental face, but with deep eye sockets and a high nose bridge.
But it looks so sharp and angular, and even gives people a heart-pounding feeling.
Just looking at Hood, her eyes were even a little blurry at this moment.
The whole person seemed to have melted into a puddle of water, and even his eyes looked a little unfocused.
“Wanda, there’s something wrong with your eyes!”
Hord’s voice suddenly pulled Wanda back.
“I don’t!!!”
Wanda’s voice suddenly rose, but the panicked look on her face made her words seem so pale.
“Alright, idiot! Look here!”
Hod scratched Wanda’s high nose bridge and made her look at her clenched hands.
Due to the mutual familiarity between Phoenix Force and Chaos Magic.
Coupled with Hood’s control over magic, he was able to mobilize the chaos magic in Wanda’s body simply by shaking hands.
When the two magical energies merged, they spread out quickly like a scarlet tide.
The scarlet light, like the rippling aurora, enveloped the entire room.
Buzz!
At this time, the original room was undergoing earth-shaking changes at a speed visible to the naked eye.
As if time was constantly going backwards, the surrounding furniture and decorations began to become retro.
As the light shone, the surroundings changed faster and faster, as if we were back hundreds of years ago.
“This is not an illusion, this is reality…”
Wanda denied it in the face of this scene, and even her tone trembled slightly.
But even she could still clearly feel that everything happening around her was extremely real.
The reality was beyond her imagination, and there was not even a single flaw to be found.
Even when each object changes, it seems as if it should be that way.
What shocked her even more was that all of this was created by the chaos magic in her body!
It took Wanda a long time to come back to her senses, and she asked with rapid breathing: “Hodder, how did you do it?”
The corners of Hodder’s mouth rose slightly: “This is chaos magic!”
Chapter 14 Wanda: Stop playing~Don’t touch me! (Old version)
Wanda looked around at the ever-changing interior of the room, her eyes full of disbelief.
“Is this the effect of chaos magic?”
She had never imagined that chaos magic could produce such changes.
I even found it hard to believe that this was the power within my body.
“This is all the result of Chaos Magic distorting reality!”
“I just used my understanding of Chaos Magic to unleash its original power!”
Hodder nodded slowly and answered with an affirmative expression.
In fact, he did not deliberately control all of this. To be precise, he was just leading Wanda to become familiar with this power.
After saying that, he took the initiative to let go of her hand.
As the scarlet light disappeared, everything in the room began to recover at a speed visible to the naked eye.
“How do you know so much?”
Wanda became more curious about the mysterious man in front of her.
Because Hood knows his own strength even better than himself!
“We’ve all had negative contact, how could I not understand.”
The corners of Hood’s mouth rose, and he reached out and pinched Wanda’s little face.
Because Wanda is relatively thin, he always thought that there should be no meat on her.
When he pinched it, he was shocked to find that it was much softer than he had imagined.
As I kept pinching it, I couldn’t help but rub it a few times. It felt surprisingly good to touch, white, soft and tender.
“Stop playing around~Don’t touch me!”
Wanda’s face turned red from being touched, as if steam was coming out of it.
Although she knew that Huo De was teasing her on purpose, she couldn’t help but think of what happened last night.
Especially after the energy fusion, she found that she was not so resistant to Hood’s contact.
On the contrary, she felt at ease when she came into contact with Hood.
Especially after what happened just now, she realized that the two of them seemed to have a lot in common.
“Okay, hurry up and tell me to control… Chaos Magic.”
Even though he already knew that the energy in his body was magic, it was still a little difficult to accept for a while.
“The studious little witch is destined to become great!”
Hod stopped and looked at Wanda with a gentle gaze: “You have to feel its presence and pay attention to its senses. It is not a simple energy, but an ancient magic!”
To control this energy, you not only need to understand how it works, but also need to meditate and comprehend it.
This is just like a car. If you try to push it with external force, it will be very difficult.
But if you are sitting in the car and step on the accelerator, it will go much faster.
“Re-understanding?”
Wanda suddenly realized.
She had previously simply used it as an ordinary energy body or mental ability.
I have never thought of re-experiencing the chaos magic in my body in this way.
If Hood didn’t tell me, I might never make any progress in my life.
But now she knows that the power of chaos magic can even affect reality.
Then when we contact each other next time, we will develop in this direction.
“Well, my lovely little witch is much more intelligent than I thought!”
Hod nodded with satisfaction: “Let’s get started! If you make a mistake, you will be punished!”
“ah?”
“punish?”
Wanda was stunned for a moment, then suddenly reacted, and the tips of her ears turned pink.
Even if it wasn’t explained in detail, she could guess that the punishment would be very humiliating!
“Turn it into anything else!”
Hod casually placed the cup on the table beside him and said, “Let’s get started!”
“Um!”
Wanda took a deep breath and her eyes became serious.
She opened her hands, and scarlet light suddenly bloomed in her hands.
As a scarlet light flashed, the cup was suddenly focused.
A crisp sound was heard, and the cup shattered to the ground in an instant.
“It’s broken…”
Wanda pouted and murmured with a look of loss.
She didn’t expect that she would face failure at the very beginning.
“fine!”
Hod pinched Wanda’s little face and picked up another cup: “Feel it carefully!”
With Hood’s encouragement, Wanda’s eyes also sparkled.
She tried again, focusing the chaos magic in her body on the cup.
But the next second, the cup shattered again.
Seeing this scene, Wanda became visibly lost.
“Don’t worry.”
Hod sat next to Wanda and said softly, “Chaos magic is not purely constructive or destructive. It can create everything, but it can also destroy everything and turn everything into nothingness.”
“Creation and destruction?”
Wanda frowned and fell into deep thought.
These two sound simple, but they are completely opposites.
Hod held Wanda’s hand, and energy burst out of his palm, causing the two energies to merge.
“But now you are more destructive and not constructive at all.”
“Chaos magic is like the harmony of yin and yang.”
“What you need to do is to make the two reach a balance point so that they can be transformed and integrated freely.”
Even as he spoke, the broken cup began to heal itself at a speed visible to the naked eye, and then returned to its original state.
Looking at the scene in front of her, Wanda subconsciously opened her cherry lips.
Although I knew that chaos magic could do it, I didn’t expect it to be so simple!
“You mean a balance?”
Wanda bent down and picked up the cup on the ground, and found that it fit perfectly without any cracks.
“Would you like to try?”
Hod took the cup from Wanda and placed it on the stool in front of him.
Wanda nodded without hesitation and closed her eyes for a while before opening them again.
She opened her hands and carefully recalled the feeling when Hod used chaos magic just now.
The brilliant scarlet light enveloped the mug.
This time, the mug did not break with the buzzing sound.
Instead, it is constantly twisting and changing, and everything around it is constantly twisting.
At this moment, the other half changed and turned into a square box.
“Success!”
When Wanda saw this scene, she excitedly hugged Hood beside her and cheered.
She really didn’t expect that she would actually succeed.
This means that she can further control her energy.
only.
Wanda was so excited that she didn’t notice that her actions made Hood’s expression become gradually subtle.
Hood finally felt what happiness was in the true sense.
Until Wanda suddenly realized that something seemed wrong with Hood. When she looked down, her movements instantly became extremely stiff.
“Witch, I helped you a lot, how do you want to thank me?”
Hodder put his hand on her shoulder with a wicked smile, and their eyes met.
Crunch crunch crunch…
The sound of wind came one after another.
It rained that night, and wet raindrops streaked across the window.
And a tree of pear blossoms covered with rain inside the house.
Chapter 15 The witch wants to eat big sausage, ghost spider is also good~ (old version)
[Ding! Your teaching is effective. Wanda has learned to master chaos magic! ][Get reward: The power of the twelve talismans! ][Ding! You and Wanda made love, making her feel great! ]In the early morning, the voice of the system sounded in my mind, and I opened my eyes drowsily.
The bed sheets were already disheveled, and Wanda was sleeping with rosy skin.
Hearing the belated system reward reminder, Hood was delighted.
“The second Phoenix fragment?!”
He really didn’t expect that his luck would be so good that he obtained the second phoenix fragment so quickly.
And the next moment, a powerful energy appeared in the body out of nowhere.
The energy flows rapidly in the body and spreads to the limbs.
The already very strong body became even stronger at this moment.
Strength emanated from all parts of the body, and the body, which was originally a little tired, became full of energy.
The comfort brought by this power made Hood couldn’t help but let out a long sigh.
He could clearly feel the surging power inside his body, like a volcano.
Because there is one more fragment of Phoenix Force, the energy in the body also increases.
The superposition of two Phoenix Force fragments is more than just the superposition of one plus one.
Instead, it will become more powerful, and even the control over the power of the Phoenix will be further enhanced.
“This is the real power!”
Hodder couldn’t help but sigh in his heart.
Even though he had received many rewards before, they were not even on the same level as the power of the Phoenix.
When I was a fragment, I might have been at the sub-God level, but now I am definitely on par with Odin, who is at the God level!
If one could obtain all the fragments of Phoenix Force, it would not be an exaggeration to say that one is the strongest being in the world.
Apart from anything else, the complete power of the Phoenix can even compile cause and effect and change destiny.
Even things as small as life and as big as the universe can be decomposed, transformed, reorganized, created and destroyed at will!
“system!”
Hod summoned the system in his mind.
The system’s light screen instantly appeared in front of Hood.
The current progress of collecting Phoenix Power was clearly written on the bright blue virtual light screen!
Phoenix Force Fragments: (2/12)
“Are we still short of ten fragments?”
Hod frowned and looked at the display.
He had never paid attention to the progress of collecting the fragments.
Because according to his original expectation, he should have collected at least one third of it by now!
“It seems that the power of the Phoenix is much more terrifying than I imagined!”
His current strength is already terrifying.
Even the god-level Thanos would have to fight him on equal terms!
“Wait! The power of the twelve talismans…”
Hood was stunned for a moment, then set his sights on the first reward.
But when they saw the words “The Power of the Twelve Talismans”, they couldn’t help but be stunned.
These are actually the twelve zodiac talismans from the adventure, and they have been integrated together.
He is most familiar with these twelve zodiac spells, and each of them has extremely terrifying abilities.
Just the eternal youth, immortality, immortality and indestructibility of a dog talisman are abilities pursued by countless people!
Possessing any one of the twelve spells is equivalent to a weakened version of Superman!
And he actually obtained all the twelve zodiac talismans just like that!
“Lucky Star is worthy of being called Lucky Star. The rewards I got these days are much better than before!”
Huo De couldn’t help but sigh secretly, and his mood became extremely happy.
“Hmm…”
Beside him, Wanda, who was lying on the big white bed, let out a moan and stretched lazily, looking extremely happy.
As soon as he opened his eyes, he saw Hood sitting up next to him and looking at him with a smirk on his face.
“Wanda!”
Hod grabbed Wanda’s hand.
Wanda had also gotten used to Hood, and feeling the warmth in Hood’s hands, she asked back.
“You really are my lucky star!”
Without saying a word, Hood turned over and pressed on Wanda.
“It’s morning…”
Before Wanda could finish her words, the room was suddenly filled with spring light.
On the dining table.
“You really can’t stop for a moment.”
Wanda, feeling weak all over, looked at Hood opposite her with resentment.
It’s only been a short time, but I can hardly count it.
She boasted that her physical fitness was superior to that of ordinary people and she could not withstand such torture.
“Why? You think it’s not enough?”
Hodder turned the remaining sausage with the silver fork in his hand.
“roll!”
“If you don’t want to eat it, give it to me!”
Wanda looked at the remaining sausages on Hood’s plate and shouted angrily.
“Here, here, it seems the little witch really likes sausages!”
Hood passed the sausage fork to Wanda and did not forget to tease her.
“Shut up!”
“Don’t contact me again if you do this again!”
After being taught by Hood, Wanda instantly understood what Hood meant, and was suddenly embarrassed and angry.
The car speed has reached 300 kilometers per hour.
“Okay, I won’t tease you anymore.”
After watching Wanda finish eating the sausage, Hod wiped the corners of Wanda’s mouth with a tissue and said, “Shall we go out for a walk?”
“No…”
Wanda shook her head without thinking, there was so much hatred towards her out there.
If she goes out now, those guys will probably chase her like crazy and fight her to the death.
She wasn’t worried about her life, she was just worried about whether she would cause bigger trouble.
“Don’t worry, I’m here.”
Hod saw why Wanda refused, and held Wanda’s hand and whispered comforting words.
Feeling the breath beside her, Wanda’s fear was suppressed a lot, and finally nodded slowly: “Okay…Okay!”
On the way to the city, the maple trees had already turned slightly yellow.
A slight chill swept into the car through the gaps in the windows.
Feeling the breeze, Wanda’s mouth corners unconsciously raised.
She hadn’t felt so relaxed in a long time.
Maybe this is the sense of security. When Hood is around, she feels like she doesn’t have to worry about anything.
As the car drove into the city, the tall buildings looked like a forest of steel and concrete.
The increasing number of pedestrians on the street made Wanda, who was sitting in the passenger seat, feel a little more depressed.
She couldn’t help but look up at Hood and tried to take a deep breath to reduce the fear in her heart.
And at this moment, a hand held her left hand, and the warmth that emerged made Wanda feel warm in her heart.
At the traffic light intersection, Hodder stopped the car.
The video was playing on a large screen outside the building.
Looking up, the ghost spider wearing a white hooded combat suit was constantly displayed on the big screen.
The tight spider suit shows off Ghost Spider’s figure to the fullest.
The special black part even made Hood’s blood boil for a moment.
It can also be seen from the picture above that the Queens borough of New York has regarded Gwen as its own superhero.
In this world, there is no Spider-Man at all, instead there is Ghost Spider-Gwen.
“Tsk tsk tsk, this figure is really good!”
Hodder couldn’t help but sigh.
It has to be said that this feeling made him even more excited when he was wearing the Ghost Spider suit.
“Um?!”
Wanda, who was standing by, felt mixed emotions when she heard this.
It’s like triggering a woman’s talent.
The next second, she stretched out her little hand and pinched Hood’s waist hard.
Chapter 16: First meeting with Gwen, Lizardman attacks! (Old version)
“I didn’t expect the little witch would be jealous!”
Hodder took a breath and rubbed his waist as if in pain.
Girls have to pretend it doesn’t hurt when they are being violently assaulted, but they have to pretend it hurts when they are being gently assaulted.
As a man who has been in many relationships, Hood is naturally familiar with this.
“You really are…”
boom!
Wanda was so angry that she was about to continue pinching him when a loud noise suddenly came from the front.
The two of them suddenly looked up and saw a cloud of dust in front of them.
Everyone who was originally sitting in the car couldn’t help but get out to check the situation ahead.
“Ah! Monster!”
“Run!”
“What is this!”
“Don’t block me, get away!”
There were screams and cries of people ahead.
For a moment, the whole street was in chaos, and people on the street were crying and shouting and running towards the back.
The vehicles in front were reversing and moving backwards.
The incident happened suddenly, and the drivers behind were unable to react in time, resulting in a large number of rear-end collisions in an instant.
The vehicles were piled together, and the sounds of horns, crying, and alarms were mixed together.
Wanda unbuckled her seat belt immediately, put her right hand on the door buckle, stared at the situation ahead and frowned slightly.
This is in the city center, and this kind of thing would never happen normally.
It is very likely that a serious incident has occurred ahead. If this is the case, then she must help.
Otherwise, there will be extremely serious casualties here.
“It seems like something is coming.”
Hodder got out of the car directly and looked ahead with a frown.
Something in the rolling thick dust was rushing towards this side at a rapid speed.
As the tall figure ran, the dust around him flowed rapidly.
The next second, a tall figure rushed out from the thick dust.
This is clearly a humanoid creature, covered with dense green scales, and with spikes like steel needles growing from the top of the head to the tail.
He was wearing a piece of white rag, and one could barely tell it was a torn shirt.
“roar!!!”
It suddenly pushed aside all the cars that were blocking its way.
The distinct roar made the fleeing citizens even more terrified.
“Dr. Connor!”
The moment he saw the monster, Hood recognized the origin of the lizard man.
“who?”
“What kind of monster is that?!”
Wanda got off the car and stared at the lizard man not far away with a serious expression.
The power of chaos emerged around her wrist, a crimson glow ready to go.
Even though she was cursed, the sense of justice in her heart would not disappear.
The lizardman threw the torn car door towards a nearby shop.
The enormous force even caused the car door to embed into the red brick wall, and broken stones flew everywhere!
“Damn it! I’m going to stop this monster!”
Wanda’s eyes focused, and she planned to rise directly into the air.
But at this moment, Hodler beside her grabbed Wanda’s wrist and said, “Don’t worry, someone is coming!”
Just see.
Amid the towering tall buildings, a nimble and sharp white figure was seen moving swiftly in the air.
“Big lizard, this is not your toy.”
As the light voice sounded, the white figure swung out an arc and kicked the lizard man to the ground.
At the same time, he did a 365-degree backflip and landed gracefully on the open space.
“It’s the Ghost Spider.”
When Wanda saw this figure, she instantly recognized the man’s identity.
The Avengers had investigated this girl before, so they had a deep impression of her.
The kicked lizardman quickly got up, exerted force with his scaly left hand, and pulled up the electric pole next to him.
With a roar, the electric pole smashed hard towards the ghost spider.
When it was waved, a huge sound of wind was heard in the air.
The ghost spider somersaulted backwards and nimbly dodged the attack.
“Your movements are too slow. You are not a qualified lizard!”
“How about this? I’ll send you to the prison first to see the animal world. Maybe you can find some interesting inspiration!”
“Here, here! Where are you looking? Don’t run over there!”
Faced with the attack of the giant lizard, the ghost spider couldn’t help but make fun of it while dodging.
These endless words made the already angry Lizardman even more frantic.
He threw the telephone pole in his hand towards the Ghost Spider and at the same time tore off the door of a Hummer.
“roar!”
The manic lizard man blocked the car door in front of him and rushed towards the ghost spider like a bulldozer.
“She talks so much!”
Wanda, who was watching the fight not far away, couldn’t help but complain.
It was the first time she saw someone chattering during a battle.
And there is no repetition in the words.
“It seems like every Spider-Man is a chatterbox!”
Hodder raised the corner of his mouth and jokingly said with a relaxed expression.
Among superheroes, only Spider-Man can behave like this when fighting.
Bang bang bang!
At this time, the sound of collision continued to come.
The lizardman who was chasing the ghost spider was fooled around and couldn’t catch the nimble ghost spider no matter what he did.
It was like a little bug flying around its ear, making it even more irritable.
Watching the ghost spider evading nimbly, the lizard man suddenly noticed two people in the middle of the road not far away.
When he saw the two people, a red light flashed in his eyes!
“This stupid lizard seems to be targeting us.”
Hodder raised the corner of his mouth and shrugged with a helpless look.
I was just watching the battle, but I was dragged into the battlefield.
“All of you go to hell!”
The veins on the lizard man’s green arms bulged, and he swung the car door in his hand and strode towards Hood.
“Damn it! Get out of the way!”
Ghost Spider’s expression changed drastically when he saw this scene.
For some reason, she hadn’t noticed that there were two people standing there.
Faced with this scene, she could only grit her teeth and stop dodging, leaping right in front of Hood.
Looking at the ghost spider that suddenly appeared in front of him, the lizard man’s voice sounded extremely excited.
He swung the car door high in his hand and smashed it straight at the ghost spider.
“snort!”
Faced with this fierce attack, Gwen could only grit her teeth and raise her hands to block.
With a huge force, her heels were smashed several inches into the ground.
The lizard man looked at the ghost spider and grinned, his sharp teeth looking particularly ferocious.
This is all part of its plan.
Before Gwen could react, its tail lashed out.
The powerful blow knocked Gwen to the ground.
At the same time, the car door in his hand smashed towards Gwen with great force and strong wind.
At this moment, Gwen looked at the car door that was getting closer and closer with a pale face, and there was no time to dodge.
At this last moment, fear made her subconsciously close her eyes.
Dust flew everywhere and a huge roar echoed through the streets.
But Gwen found that she was actually fine, she squinted and opened her eyes.
And a tall figure stood in front of her.
The man was wearing a black T-shirt and had one hand in his pocket. He leisurely caught the heavy car door with one hand.
“Stand back!”
Chapter 17: Girls have their own advantages, the power of spells! (Old version)
In the chaotic streets, several vehicles on fire made sounds of burning materials exploding from time to time.
Pungent black smoke and dust drifted in the air, and apart from these sounds, the almost deserted streets were extremely silent.
The burly figure raised his lips and squeezed the car door with an indifferent expression.
Gwen Stacy, who was lying on the ground, stared at the figure with her eyes wide open. Who is this person?
She had never seen this person before, so he shouldn’t be a member of the Super Heroes!
But it could actually easily block the Lizardman’s tremendous power.
“This…how is this possible!?”
The erect pupils of Lizard Connor suddenly shrank into needle points.
The super power that I worked so hard to obtain seemed so powerless in front of this strange man!
Just now, in order to directly get rid of the ghost spider, he had clearly used all his strength.
But the man in front of him blocked it with just one hand, with his left hand in his pocket, looking very relaxed.
“Why.”
Hod raised the corner of his mouth and said teasingly: “You are so weak, why don’t you just stay in the sewer? Why are you wandering around here?”
Just saw in the conversation.
A blue light appeared on his wrist. If you look closely, it is clearly a pattern of a bull’s head.
This is clearly the power of the bull spell!
Possessing the Bull Talisman will grant you the power of strength and super stamina.
The powerful magic of the bull can make the holder extremely powerful, greatly increase the physical strength of the whole body, and greatly enhance brute force.
At the same time, the striking force, impact force, physical attack destructive power, etc. will be greatly enhanced.
Although it may not be enough when facing a cosmic-level strongman.
But the enemies on the surface can be said to be at ease.
“Damn it!”
Lizard Connor roared angrily. This humiliation was simply unbearable for him.
The huge tail swung violently and lashed towards Gwen on the ground.
Seeing this powerful blow, Gwen put her hands on both sides of her head to dodge.
In a flash.
Hood suddenly raised his foot and kicked the lizard, and when he raised his foot, a huge sound of wind was created!
The lizardman crashed into the wall of the street like a kite with a broken string.
The broken wall collapsed, leaving a huge hole.
“This power!!! Is this a carbon-based organism?!”
Gwen was stunned. She had felt the lizardman’s terrifying power when she faced him just now.
The opponent’s strength is enough to even tear a car apart with bare hands.
But in front of this young man, he was easily solved? !
She even saw a hint of satisfaction in the young man’s expression.
It was as if he had just slapped an ant to death.
Gwen now even doubted whether she was dreaming. This was simply not a level of power.
“How long are you going to lie on the ground?”
Hood retracted his legs and looked down at Gwen on the ground with a calm expression.
Gwen was stunned at first: “Oh…sorry…”
Only then did she come to her senses and found herself still lying on the ground.
But just as she was about to jump up, she suddenly felt a surge of hormones coming over her.
This mysterious man actually knelt on one knee and picked her up.
The sudden princess hug made Gwen’s head buzz.
Her brain seemed to be shutting down, and her face beneath the mask became extremely hot.
I never expected that this person would be like this!
This was the first time she was held in this way.
“Well…well, I’m fine! I can do it myself!”
After a moment.
Gwen stammered and shouted, her body twisting involuntarily.
I don’t know whether it was intentional or unintentional, but every move seemed so ambiguous.
Through the thin ghost spider suit, one could even feel the warmth from the man’s palm.
This made her heart beat faster, and the big eyes on the mask widened slightly.
“Um.”
Hod nodded slightly, then turned sideways and let go of Gwen with a calm expression.
Wanda, who was not far away, glared at Hood fiercely before turning her gaze to Gwen.
Although Hood was serious now, she felt that Hood was not that kind.
“I’m fine.”
Gwen shifted her gaze to the woman approaching from a distance.
When she saw this person, her eyes widened.
“You…you are the Scarlet Witch?! I actually ran into an Avenger!”
“I am your die-hard fan. I have always admired you!”
“Don’t worry about the nonsense those guys outside are talking about. I know that’s not the case!”
“And… you’re really good-looking!”
After seeing Wanda, Gwen forgot everything that had just happened.
He trotted up to his idol and chattered excitedly.
“Thanks!”
Facing the lively Gwen, Wanda smiled and nodded.
“By the way, are you also a superhero?”
Gwen turned her head to look at Hood, frowned and thought for a long time without any impression: “But why haven’t I seen you before?”
Because she follows the news about the Avengers very closely, if she had been on TV, she should have some memory of it.
But this young man should have never appeared at all.
“I’m not a superhero.”
Hood shook his head slightly with an indifferent expression, and his eyes subconsciously glanced at Gwen’s figure.
85, 56, 90.
Tsk tsk tsk!
This is a very good figure for this age group!
Although Gwen’s height and figure are not as good as Wanda’s.
But Gwen had a very different aura.
If Wanda is melancholy and charming, then Gwen exudes youthfulness everywhere.
Just like an 18-year-old college student.
Just as Hood was admiring the beauty, he suddenly heard the sound of gravel behind him.
The lizard man slowly walked out of the hole, panting and looking at the few people.
Looking at these three people standing here chatting, he was so angry that his whole body couldn’t stop shaking.
It’s clear that they don’t take him seriously at all!
“I almost forgot you were still here.”
Hod withdrew his gaze and looked at the lizard man with displeasure.
I was reminiscing about the beauty of my youth, and this crappy lizard man popped up again and again.
This really dampened his mood.
“Die!”
The lizard man Connor was furious and extremely angry at Hood’s contempt. He rushed towards Hood like a madman.
BANG BANG BANG!!!
When the angry lizardman ran, every step he took caused the ground to shake slightly.
Even the ground where you run will be left with cracks.
“Hodder, be careful!”
Wanda looked at this menacing scene and couldn’t help but open her mouth to warn.
This monster looks like he’s going to fight to the death.
“He is very powerful, be careful…”
Gwen also took a fighting stance, ready to provide support at any time.
Boom!!!
But before he could finish his words, a scorching ray shot out from Hood’s eyes.
This terrifying light seemed to be able to penetrate everything in the world.
The overwhelming force pierced directly through the lizardman’s chest.
The moment it penetrated, green blood splattered out.
The lizard man looked down in disbelief, his pupils trembling constantly.
A huge bloody hole was left in his abdomen.
Through the blood hole, you can also see the scene behind.
Chapter 18 Mysterious Hod, Gaining a Fangirl Gwen! (Old Version)
“Hehehe…”
Lizardman Connor looked at the huge hole and his eyes became dim.
“This… How is this possible?”
He staggered back several steps and fell heavily to the ground.
Green blood flowed and seeped through the cracked ground.
“You…you actually know this trick?”
Wanda looked at Hood in disbelief.
This cast a thick fog over Hood’s already mysterious figure.
At the same time, this reveals an indescribable charm.
She had thought that Hord was only powerful in strength and magic, but she discovered that was just one aspect of the man.
She didn’t know Hood at all. This was much more mysterious than she had imagined.
Mountain climber, entrepreneur, met Tony Stark, self-made man.
He understands magic, knows chaos magic, and possesses the same ancient energy within him.
She thought this was the limit, but the laser just now refreshed her cognition.
And she could keenly feel the power contained in that light.
“Are you really not a superhero?!”
Gwen was shocked. She looked at the calm Hood in front of her with admiration: “That move you just made was really cool. How did you do that ray?”
As she spoke, she gestured excitedly. She was shocked by the scene just now.
“talent.”
Hod pulled his hand out of his pocket and rubbed Gwen’s excited little head: “Want to learn? I can teach you!”
“Ahem, Hood, this can be left to others to handle.”
Wanda, who was standing by, interrupted their conversation for some unknown reason.
She didn’t know why, but when she saw the intimate behavior of the two people here, she felt uncomfortable all over.
Especially that familiar head rubbing, she already felt that it was exclusive to her.
But now that Hood did this to others, she felt mixed emotions.
But she also knew that the two of them had not done anything too out of line.
Suddenly, a deafening explosion was heard from a building not far away.
The huge explosion even caused the ground to tremble slightly.
“not good!”
Gwen heard the noise and her face turned pale: “I forgot about the important matter!”
Wanda looked at the situation in the distance, frowned and asked.
“The Lizardmen intend to spread gas tanks containing mutation ingredients throughout New York, causing everyone to mutate!”
Gwen said as she took a running start and leapt into the air, quickly swinging towards the scene of the incident.
She knew very well that if there was a problem with the gas tank, no one in New York would be spared.
This is also the purpose of the Lizard Man Connor, which is to turn everyone into reptiles!
“Let’s go! Let’s go too!”
Hood thought about it, and he and Wanda flew towards that direction quickly.
The first floor of the towering building was ablaze with flames and explosions were heard from time to time.
The raging flames rolled and spread in all directions, thick smoke rose up, and the terrifying heat wave made the air distorted.
Black smoke rolled out from the breach and rolled around, turning the surrounding walls black.
At this time, the deep blue sky was covered with thick smoke, and the raging fire spread along with the heat wave, mixed with strange green smoke.
“Come and save people! Call the fire department immediately!”
“Someone come save my children, they are still in there!”
“Don’t pull me, I want to go in and save my wife!”
“Where is the fire hydrant? Someone come and help!”
“……”
People outside the building were running and screaming. Many of them had hidden inside because of the riot caused by the Lizardmen.
But no one expected an explosion to happen, and because of the huge crowd, many people were trapped inside the building.
There were wailings outside the building. Some people rushed into the building, but were forced back by the scorching flames and suffocating black smoke.
“We have to put out the fire quickly! Otherwise, the flames will sweep across New York along with the green mist!”
Gwen stood on the building and looked around nervously, trying to see if there was a water tank nearby.
If we don’t hurry, even if the people in the building survive by chance, they will be infected by the green fog and turned into reptilian monsters!
“Wanda?”
Hod noticed that Wanda beside him looked dazed, with a mixture of fear and hesitation on her face.
“Hod, the fire is too big, I can’t do it!”
Wanda’s voice trembled, and everything in front of her began to overlap with the memories in her mind.
She wasn’t sure if she could really do it, and if she didn’t…
During the German mission, her mistake caused the building to explode.
The explosion also caused a fire, but she failed to put it out.
“You can do it.”
Hod held his shoulders and said encouragingly: “Chaos magic can destroy everything, but it can also create everything.”
“Yes! I can do it!”
Wanda felt the warmth and trust, and the missing confidence in her heart returned.
She took a deep breath and slowly walked towards the fire.
The determined figure formed a sharp contrast with the frantically fleeing crowd around him.
“What is she going to do?”
Gwen wondered.
If she remembered correctly, Wanda should have no way to put out the fire.
“Fire!”
Hood hopes that this incident can help Wanda overcome her inner demons.
If you don’t face fear head-on, you will always be surrounded by fear.
And this is the best time!
“Who is that person? Why is she walking towards the fire?”
“I remember now, this woman seems to be the Scarlet Witch!”
“Why is she here?! Could it be that she wants to kill the people inside?!”
“God, Chaoying is finally here, please save my child!”
“But what’s the point of her coming here? This guy only kills innocent people!”
“Shut up, no one will make a mistake. Now we can only put our hope on her!”
“Yes, after all, Scarlet Witch once saved New York!”
The gossip coming from all around made Wanda’s firm steps become a little hesitant.
What if I screw up again?
“Don’t be afraid. There are very few celebrities in the world who don’t have haters.”
“Look at Tony, he’s still alive and well despite all the rumors and gossips he’s been through.”
Hodder stood aside and made an inappropriate joke.
He knew very well and understood Wanda’s fragile heart.
She herself is a poor person who is sensitive and inferior.
He lost both his parents when he was young, and he depended on his younger brother for survival, struggling to survive in the gunfire.
He finally escaped to the United States and ended his years of revenge, but his brother died.
This is unacceptable to anyone.
And it is precisely for this reason that chaos magic will infinitely magnify the fragile side of one’s heart.
“Hodder, you’re right.”
Wanda’s eyes became more determined. She looked at Hood deeply and murmured in a voice that only she could hear: “I still have you.”
The fire scene, which continued to sweep the flames, caused another explosion.
The people trapped in the building screamed in despair.
Wanda took off her hood with a determined look and threw her cap to the ground.
At this moment, she plucked up the courage to reveal her true face.
Everyone’s eyes were focused on Scarlet Witch.
She opened her arms and her clothes fluttered in the air.
The scarlet light surrounded her like a stream of light.
Wanda floated up surrounded by scarlet light.
Chapter 19: Wanda resolves her inner demons, thanks to Hood! (Old version)
The scarlet light swirled around Wanda like an elf.
The jumping light illuminated the surroundings, and the red hoodie looked scarlet at this moment.
Under the dazzling light, the light yellow hair was rendered red.
The delicate face looks even more beautiful at this moment.
“What a nice view……”
Gwen watched this scene, her eyes widening in her mask as she exclaimed.
The Scarlet Witch at this moment is just like Freya in mythology.
“Scarlet Witch is indeed more attractive!”
Hod stared at Wanda floating in the air and sighed.
I have to say, Wanda is even more charming at this time.
He finally understood why most people found witches more attractive after turning evil.
Wanda opened her arms, and scarlet light spread towards the fire like a tide.
Under the suppression of the scarlet light, the howling flames were gradually suppressed.
Even the surrounding black smoke was compressed into a ball by the power of chaos magic.
As the scarlet light compressed inward, Wanda’s expression became more solemn.
This is chaos magic controlled on a very large scale, which requires extremely delicate operations.
“call……”
Fine beads of sweat covered her forehead and Wanda kept moving her hands.
While in Germany, she had tried to compress the explosion, but that had had dire consequences.
She could even clearly sense the emotions of everyone around her. Their hearts were filled with pain, despair, and fear…
The appearance of these images caused the chaos magic she controlled to become chaotic, and even the flames that were originally suppressed began to spread outward at this time.
Hod frowned slightly as he looked at the pain on Wanda’s face.
He knew very well that it was not difficult to do all this with the power of Scarlet Witch.
The real difficulty now is how Wanda can overcome the obstacles in her heart.
This was not something he could help with. She could only rely on herself to get through this difficult time.
He controlled his body and floated to Wanda’s side.
“Forget the past. Now only you can save them. Think about what I said before.”
“Actually, this is nothing to you. Believe me, you will never fail!”
Hood’s deep voice rang in Wanda’s ears.
Wanda didn’t look back, but she was very clear that Hood was standing next to her.
She could even clearly smell the familiar scent of cologne on Hood under the burning temperature of the flames.
Wanda took a deep breath and her eyes became gradually firmer.
right!
That’s right!
Now she is the only one who can save the people inside, and she is the only one who has this ability.
Whether she tried or not, that was her only choice now.
Even if I want to retreat now, it’s too late. I can only try my best.
Her thoughts went back to last night, and what Hodder had said flashed through her mind.
“Chaos magic is not purely destructive, it can also create and change everything!”
“So I can definitely do it! Create everything!”
Every time Wanda remembered a detail, the scarlet light became more brilliant.
She continued to press her hands together, and the crimson light flowed more smoothly in her hands.
As if this was a matter of course.
As the light grew brighter, Wanda’s heart became more determined.
The fire that had already begun to spread was compressed at a faster rate.
With a buzzing sound, a strange scarlet light suddenly burst out like a tide.
The fluctuating scarlet light surged toward the entire block.
Like a wave, the entire neighborhood was enveloped in red light.
Even the color of the sky turned scarlet at this time.
Looking from below, it looks like a red ocean.
“What is this? Is this the power of Scarlet Witch?”
“This is so beautiful, can the world change for it?”
“I never thought that superheroes would possess such powerful strength!”
“Is she going to destroy the entire neighborhood again like she did last time?”
No one knew who shouted this, but the originally stunned crowd suddenly became extremely panicked.
Under the influence of media propaganda, Scarlet Witch has become the symbol of destruction.
Seeing this strange scene, fear began to spread among the crowd like a plague.
This unknown power frightened everyone to the extreme. They wanted to move, but their legs kept shaking.
But at this moment, someone suddenly noticed that the fire on the first floor was being extinguished at a speed visible to the naked eye.
Surrounded by the scarlet light, even frost began to form.
Frost began to spread along the ground and walls, and as the temperature dropped, the flames disappeared.
“Scarlet Witch put out the fire!”
“This is incredible. I didn’t expect she would really come to save us!”
“Woo woo woo, great! My daughter is saved!”
“Who just said he wanted to kill us?”
The people opened their eyes wide when they saw this scene.
They didn’t expect that the Scarlet Witch, who they thought was the cause of destruction, actually put out the fire.
If this continues, the fire will soon be extinguished by Scarlet Witch.
“The green mist actually turned into ice mist and dissipated!!!”
Gwen slowly landed on the ground and sighed at the scene in front of her.
She hadn’t expected Wanda’s power to be so strong.
You know, this is a building of several thousand square meters! All the flames were suppressed by Wanda alone.
Even now the fire is showing signs of dying down.
“It seems like she has finally overcome the obstacle in her heart!”
Hodder returned to the ground, took out a cigarette and held it between his lips, muttering with satisfaction.
As long as she overcomes the psychological barriers, Wanda will soon be able to emerge from the shadows.
And after this incident, Wanda’s power to control chaos magic will inevitably become stronger.
He looked at the hard-working little witch, lowered his head slightly, lit a cigarette, and exhaled turbid smoke with the corners of his mouth raised.
After a while, the raging fire was finally extinguished.
After Wanda finished all this, she finally breathed a sigh of relief.
As soon as he landed, deafening cheers rang out all around him.
“Long live the Scarlet Witch!”
“It worked! Scarlet Witch saved us!”
“Scarlet Witch is here to help us!”
“I will never question Scarlet Witch again!”
Everyone couldn’t help but cheer at this moment.
At this moment, Scarlet Witch subverts the stereotypes that the media has given them.
They all gathered together and surrounded Wanda.
Scarlet Witch looked at the excited crowd around her and couldn’t help but wipe away the tears flashing in the corners of her eyes with the back of her hand.
She didn’t know how long it had been since she saw others cheering for her.
And people around her are now thanking her.
She knew very well that she was able to do this because Huo De stood firmly by her side.
…………..
[PS: I am begging for flower evaluation tickets and monthly tickets. If you don’t have flower evaluation tickets and monthly tickets, you can just say something in the book review area! Thank you all for your support!!!]Chapter 20 Wanda’s Dependence, Kabuto Insect Meter! (Old Version)
At the Avengers base, the atmosphere in the office was quiet and dull.
Tony sat in the chair sadly, chewing dried blueberries, and occasionally glancing at Steve on the sofa opposite.
The two remained silent.
The only sound was Tony eating dried blueberries.
With the recent developments in Germany, official pressure is increasing.
The solution proposed by Hood is good, but the current situation makes it impossible to start.
The public relations image and reputation of the Avengers and Wanda will not change unless there is a good opportunity.
“Are you going to sit there forever?”
Tony patted the dried blueberries on the table and looked at Steve, who was playing with his phone silently with his head down.
“What else can be done? The only thing that can change anything is to make Ross change his words!”
Steve looked at Tony with a cold face.
Now Ross’s idea is to control the Avengers, and these public opinions are definitely Ross’s instructions.
Otherwise, it would be absolutely impossible to expand the influence to this extent relying solely on these media.
“It’s better to go talk to Wanda about this than to sit here!”
Tony walked up to Steve and said with suppressed anger: “Don’t forget, it was you who organized the mission in Germany!”
“It’s my fault for organizing it, but didn’t you do anything wrong?!”
Steve Rogers glared at Tony Stark with gritted teeth.
He admitted that the last incident was an accident, but it was not his intention.
What’s more, he never thought it would be that serious!
“Me? I’m always trying to clean up your mess!”
“Do you know how many media outlets I’ve contacted? I’ve been trying to find a solution!”
Tony clenched his fists and growled.
And what about the so-called Captain America?
Just holding on to your own unrealistic ideals and sitting here motionless!
It would be a lie to say he wasn’t angry. If he had so much time, he could at least go and persuade Wanda!
“Hehe, you weren’t like this when you were in Sokovia.”
Steve clenched his fists, his breathing became rapid: “Countless people died because of this, no! It was because of you that they died!”
“You think this is me…”
Tony was about to retort when he heard the office door behind him being pushed open.
He turned around and saw the Black Widow Natasha standing at the door.
“It seems that I am here at the wrong time.”
Natasha shrugged her shoulders and spoke in a teasing tone, making the atmosphere in the office less solemn.
“What’s the matter?”
Tony picked up the dried blueberries and started chewing them.
“I think you should see this!”
Natasha turned on the TV.
What comes into view is the scene of Wanda putting out the fire on the scene.
I saw a large number of people surrounding Wanda and cheering and shouting.
[At 13:41 this afternoon, the Avengers member Scarlet Witch and the city center prevented the spread of a fire…]The reporter’s voice came from inside.
Tony saw this scene, and his gloomy expression eased a lot at this moment: “Wanda awakened a new ability?”
If he remembered correctly, although Wanda could indeed suppress the flames, she had no way of turning the flames into ice.
Now this was the only possible explanation for what they had seen.
“I didn’t expect we didn’t even notice it!”
Steve Rogers spoke with a surprised expression.
They are basically all in the Avengers base, so logically they should know about awakening new abilities.
But he actually awakened this ability without making any noise, and even used this ability to save so many people.
“This must be because she just woke up, because Wanda’s expression is still a little forced.”
Natasha swung the remote control in her hand and continued with a thoughtful look, “But the more important thing now is that this incident has gradually changed the media’s coverage of Wanda!”
After all, with so many people witnessing this, the media certainly cannot change the report at will.
This is a good opportunity for them. If they handle it well, they may be able to reverse the impact of the previous German incident.
“Don’t worry, I will ask the media to do a good job and try my best to change everyone’s impression!”
To tapped the earphones lightly with his fingers.
“Call Pepper!”
After the call was connected, he got straight to the point: “Little Pepper, help me arrange some PR, and then go pick up Wanda!”
After so many years in the business world, he has long been familiar with these operations.
The most important thing now is to strike while the iron is hot and take advantage of this opportunity to find a way to restore our reputation in one fell swoop.
“But Wanda seems to be in a good mood.”
Natasha Romanoff couldn’t help but sigh as she looked at the smile on Wanda’s face in the picture.
She hadn’t seen Wanda smile for a long time.
“By the way, how come Wanda suddenly came to her senses?”
Steve Rogers sat back on the sofa, looking at the picture on the screen with a confused look on his face.
He looked depressed just a few days ago.
But now he is like a different person, even his abilities have become more powerful.
“Maybe, she finally figured it out!”
Natasha Romanoff was also infected by Wanda’s smile and said with a smile.
Things seemed to be slowly getting better at this time.
Tony smiled and said, “We’ll know when she comes back.”
At this time, in Queens, New York.
[Ding! You helped Wanda get rid of her inner demons and restored her reputation! ][Get reward: Kabuto Insect Meter (Kabuto)! ]Hood leaned against the wall not far away, looking at Wanda who was being interviewed, and suddenly a prompt sounded in his mind.
[Kabuto Insect Meter]: Use this insect meter to transform into Kabuto, which requires the approval of the insect meter.
“Kabuto Insect Meter!”
“Wanda is really full of treasures! Every reward is top-notch!”
Hood couldn’t help but feel happy, he didn’t expect that he could get a reward.
Kabuto Insect Mechanic is Kamen Rider Kabuto’s transformation device.
Yes, it is that narcissist who follows the will of heaven and controls everything.
However, few people would refuse his transformation device. When he was a teenager, Hod had dreamed of owning a knight’s belt.
“Mr. Hodder, now that it’s all over, I’m leaving now. I hope we can have another chance to work together in the future. Please say goodbye to Wanda for me.”
Gwen saw more and more media coming and took the initiative to speak.
She doesn’t like those annoying media asking her questions.
“goodbye.”
Huo De waved his hand, and watched the girl’s back disappear among the tall buildings. He thought to himself, “It seems that I can only wait until later to get to know her better.”
At this time, a row of black luxury cars drove over from the distance.
“I should go back too.”
Hod saw the Stark Group’s special car appear and prepare to leave.
He knew Tony would definitely make good use of this opportunity to save the reputation of the Avengers.
In order to crush Lord Ross’s plan against the Avengers.
When he left, he did not forget to convey the message with his spiritual power.
[Hodder]: See you when you have time. Enjoy today’s glory.
【Wanda】: Thank you for today.
Chapter 21 The Man Behind Wanda? Tony’s Investigation! (Old Version)
Far away in Northern Europe.
In the night, in the eerie forest, a dark atmosphere surrounded.
Wow wow wow…
The black crow flew around in the sky and slowly landed on an old house.
“Hohoho…that breath!”
In front of the old-fashioned TV, a middle-aged woman in a black robe was very excited.
A gloomy picture was playing on TV, and the picture on it was exactly the scene of Wanda putting out the fire.
“Oh Allah Almighty! The great Sithon, Chaos Magic has finally appeared!”
The woman grabbed the sides of the TV.
In the dark room, her blue eyes reflected the images on the screen, and her eyes were filled with endless greed.
If Hood were here, he would definitely recognize it at a glance.
The woman was Agatha Harkness!
“New York! Chaos Magic! Here I come!”
Agatha Harkness opened her arms, her black robe fluttering in the wind.
Countless black mists quickly spread out from under the black robe and instantly engulfed her entire body.
And the next moment, Agatha Harkness was no longer in the old house.
Avengers Base.
Today is definitely the most fulfilling day for Wanda. Various interviews made her very tired, but she enjoyed it.
When she returned to the base, she wanted to go back and rest, but she saw all the Avengers waiting in the living room.
Wanda looked at everyone in surprise: “Why haven’t you all gone to bed yet so late?”
Although this is the Avengers base, there is very little time for everyone to gather together.
Seeing so many people sitting here now, she began to wonder if something big had happened again.
“Congratulations! Today, the public’s support for you has skyrocketed. It won’t be long before you can completely change the previous situation.”
Tony was the first to smile and raise the glass in his hand.
Today’s public relations can be said to be very successful, and the Internet’s views on them have gradually begun to change.
In the current situation, we will be able to get rid of the current predicament soon.
“After you did that, those annoying guys outside finally stopped shouting about attacking us.”
Falcon Sam shrugged and teased.
Those guys hold up signs outside every day. Although the Avengers base has good sound insulation, it’s still a headache to watch.
No one would be able to stand seeing a group of lunatics shouting downstairs of their house every day.
“I didn’t expect you to do such a big thing without making any noise. This really exceeded our expectations.”
Natasha slumped her legs over the table.
It has to be said that Wanda did bring them an unexpected surprise today.
“You did great, but what exactly is your new ability?”
Steve was curious.
Everyone looked curious when they heard this, because the flame was filled with green mist that could cause mutations.
If it is just compression, there is definitely no way to solve the green mist.
But Wanda actually used an ability that no one had ever seen before.
“I didn’t awaken any new abilities. In fact, I used my previous powers.”
Wanda walked over to sit next to Natasha and picked up a pillow: “It’s just that I learned how to control it better.”
Since they were all companions, she had no intention of hiding anything and just spoke out.
“Not a new ability?!”
Tony was shocked, he never thought that Wanda’s abilities would have other changes.
And we can also learn from Wanda that she already has this ability, but she just discovered it today.
“Aren’t your abilities granted by the Mind Gem?”
Tony was a little confused.
Wanda hugged the pillow and shook her head in confusion: “I don’t know either. He didn’t explain it to me clearly…”
When Wanda said the word “he”, Tony Stark quickly grasped the key point: “Who is this he?”
It’s obviously someone no one knows, and he may be the key to Wanda learning to master her abilities.
“this…..”
Only then did Wanda realize that she had let the cat out of the bag.
It’s impossible to tell what happened between Hood and myself now!
But now she couldn’t think of a suitable excuse.
But if you really say it…
How should I explain my relationship with him?
“If you’re hiding something from us, one small mistake could ruin everything.”
Tony didn’t stop asking questions, but pressed on with a serious expression.
This unknown person is likely to interfere with their plans!
Wanda hugged the pillow tightly, almost burying her entire face in it.
She gritted her teeth, her face full of hesitation.
Because she really didn’t want to tell what happened.
“Wanda, why don’t you go and rest first!”
At this moment, Steve took the initiative to speak up and help Wanda out of the predicament.
“Yes, you have been busy all day today, you must be very tired!”
Natasha also took the initiative to speak. As a woman, she had vaguely sensed something.
Only these rough guys could not see Wanda’s shy look.
And this person must be very important to Wanda, otherwise, with Wanda’s personality, she would definitely not hide it from everyone.
When Wanda heard this, she felt relieved and quickly threw down the pillow and left in a hurry.
“you……”
Tony looked at Wanda’s back as she left, his brows furrowed.
“Tony, she has the right to make her own choice, and everyone has their own secrets.”
Steve stopped Tony and said seriously, “And there are some things that maybe it’s better not to know.”
“But this concerns all of us.”
Tony’s expression was solemn.
“If you’re bothered by this, you might as well think about how to convince Ross.”
Steve frowned. If they really joined the official team, the Avengers would become tools.
Tony heard this and said coldly: “Then you decide!”
After saying that, he turned and left.
In the office.
Tony Stark sat on the leather seat and called Pepper directly.
“Go and help me investigate who has been in contact with Wanda recently!”
He would never feel at ease if he didn’t investigate it thoroughly.
After doing all this, Tony Stark looked tired.
He has been feeling a lot of pressure these days and doesn’t even know how to vent it.
“Why don’t we go find Hod?”
This idea was dismissed as soon as it emerged in his mind.
Because Hood is always busy.
After hesitating for a long time, Tony Stark came to the balcony, put on his combat uniform and flew out directly.
Get ready for a nice ride to relax.
Chapter 22 It’s late at night, go find Gwen! (Old version)
Inside the manor.
“Imelda, go and inform everyone that today is a day off.”
Hodder came to the hall and asked the maid to notify everyone to rest.
The reason why he gave the servants a holiday was because he planned to give the armored insect instrument a try.
After Imelda bowed and expressed her gratitude, she immediately notified all the servants to leave.
“Is this the Kabuto Insect Meter?”
Hood flipped his hand and took out the Kabuto insect detector from the system.
I saw a transformation device in the shape of a rhinoceros beetle, made entirely of steel, appear in his hand.
Just as he was carefully looking at the Kabuto insect instrument in his hand, the rhinoceros beetle in his hand suddenly made a loud noise.
In just a moment, the rhinoceros beetle broke free and flew out.
“Want to escape?”
Hodder opened his hand and pulled violently.
The power of the phoenix brought the rhinoceros beetle back into his hands.
At the same time, he held it tightly, firmly controlling the rhinoceros beetle in his hand.
Directly use force to subdue Kabuto Insect Instrument.
“Transform!”
【KABUTO! 】
Hod slashed the Kabuto insect meter in his hand.
Golden light burst out in the Kabuto insect instrument, and green light like a nano-barrier spread rapidly on Hood’s body.
The moment this light enveloped the whole body, there was a flash of white light.
Kabuto’s battle suit appeared on Hod’s body.
A mysterious force was flowing around Hood’s body.
“Is this Kabuto?”
In front of the mirror, Hood looked himself up and down.
He directly transformed into a knight with his armor exploded, and had a long horn like a rhinoceros beetle on his head.
It fits the temperament of the King.
Compared with Tony’s Iron Man suit, each has its own merits.
“We need to go out for a walk!”
Hod looked at the silver-white armor and couldn’t suppress his impulse.
It’s still late at night, so it’s a good time to go out for a walk without attracting too much attention.
Thinking about this, Hood came to the garage.
There were all kinds of vehicles parked in the garage.
There are flying Fords, unicycles, flying Mercedes-Benzes, and jet motorcycles.
Many of these vehicles were rewards from the system, and he simply left them in the garage.
Hod came to a dark black motorcycle.
This motorcycle looks similar to the Harley Fatboy, except that the position of the exhaust pipe has been greatly changed.
The display screen in front of the car is completely different from previous ones. It is even a projected 3D display screen.
This is also a vehicle rewarded by the system.
[Amphibious motorcycle]: A three-purpose motorcycle for land, air and water!
Hood took a step back and sat on the motorcycle casually, then just slightly twisted the accelerator.
The amphibious motorcycle roared instantly, and with a slam dunk, it drove straight out of the garage.
“Cool!”
Hod felt the wind blowing and pressed a button on the accelerator handle.
I saw two jet pipes popping out from both sides of the front and rear wheels of the motorcycle.
With a twist of the throttle, the jet pipe burst into blue flames.
On the road, a beam of light shuttled across it rapidly. Hood’s extremely fast nerve reflexes allowed him to handle it with ease even at a speed of 500 kilometers per hour.
“Hell’s Kitchen?”
After hesitating for a moment, Hood decided to go to Hell’s Kitchen, maybe he could see Gwen there.
Hodder slowed his motorcycle down on the dark streets of Hell’s Kitchen, New York.
When it drove into the neighborhood, it immediately attracted a lot of onlookers.
“Hey, man, your COS is very handsome!”
A black man with dreadlocks waved at Hod, and there was something bulging around his waist.
New York is a city that never sleeps, and Hell’s Kitchen is completely different from New York.
The streets were dark and messy, with all kinds of graffiti sprayed all over the walls.
With runes and patterns from different cultures, the vector image seems to be accusing this complex city of chaos.
Just like the mixed bloodlines running in the blood of the people in this area.
From time to time, one can see people lying on the dirty streets, and it is unclear whether they are enveloped by alcohol or death.
Here, chaos, crime, blood and death can be seen everywhere.
“Hey!”
“Boy, your car is pretty cool, now leave it behind and get out of here! This is Mr. Kingpin’s territory!”
The man with dreadlocks raised his right hand and waved it in the air twice, and the other people around him surrounded him.
The people around were talking and patting the gun handles on their waists.
“Kingpin?”
Hodder was stunned when he heard this.
I didn’t expect there was a Kingpin in this universe.
Anyone who has watched Marvel has heard of the name Kingpin.
The emperor of the underworld has absolute power over the East Coast.
He is extremely meticulous and his wisdom far exceeds that of ordinary people.
More than 90% of his body is muscle, and some say he can even punch through a wall with his bare hands.
“I don’t know if there will be any benefit from getting rid of Jin Bing.”
Hodder muttered to himself as he sat on the seat of his motorcycle.
Its own system reward mechanism seems to be a special event.
“Kid, why don’t you leave? Don’t think you won’t get beaten just because you’re wearing strange clothes!”
The man with dreadlocks curled his lips in a bad mood. If the man in front of him didn’t know how to appreciate his courtesy, then don’t blame him for being rude.
“Hey, why is this necessary?”
Hod shook his head, lowered the support of the motorcycle, and suddenly attacked.
With just a swing of his leg, he sent the person next to him flying backwards.
“You want to die!”
The sudden attack made the man with dreadlocks pull out the revolver from his waist.
But before he could pull the trigger, a large hand wrapped in steel suddenly grabbed his revolver.
Snap!
With a loud bang, the revolver and the left hand of the man with dreadlocks were crushed into a ball.
Aaaaahhh!!!
The screams immediately echoed in this crime-ridden street.
At this moment, the others took advantage of this opportunity, drew their knives and launched a sneak attack.
But in front of Hood, it was just like a child playing house.
After just a few twists and turns, these thugs fell to the ground, wailing.
At this time, high in the sky.
A steel-red shadow flashed by, it was Tony who had just come out to relax.
He noted below: “Closer view Friday.”
Looking down, I saw a guy in red and silver clothes struggling with the thugs.
Tony was stunned, and murmured with a helpless smile: “I didn’t expect to run into fans when I go out.”
Chapter 23: Gwen has a big heart and a big horn! (Old version)
Tony just smiled and shook his head, then turned around and flew somewhere else.
Even from high above, it was clear that the guy in red and silver clothes could easily deal with those bastards.
He doesn’t care about this kind of shit.
“Tell me! Where is that bastard Kingpin?”
Hood grabbed the gangster with tears on his face, grabbed his collar and pressed him against the window of a car nearby.
His entire face was pressed against the car window, and the brute force caused the man to utter wailing sounds.
“I don’t know what you are talking about! Let go! It hurts, it hurts…”
The gangster gritted his teeth and yelled at Hood.
Although I know the whereabouts of Jin Bing, I will be dead if I tell it.
Jin Bing is the emperor of the underworld. He knows what is important just by thinking about it.
“Hey, can’t you just tell me the truth?”
Hod sighed helplessly, his eyes suddenly became fierce, he suddenly picked up the man and slammed him heavily on the hood.
The gangster curled up like a shrimp in pain, his whole body shaking uncontrollably.
Just with this one blow, the gangster felt as if his internal organs were shattered.
He was breathing rapidly, and his face was covered with bloodshot from the pain.
“You’re still being stubborn. It’s okay. I have time.”
Hood looked at the man in front of him calmly, without any fluctuation in his heart.
I have no sympathy for this kind of gangster, especially since he has done many things to harm others.
As can be seen from the tattoo on his face, three people died at his hands alone.
Before the gangster could say anything, Hood grabbed the gangster’s hand and squeezed it hard.
Crack!
“Ahhhhhhh!!! I said! I said!”
The gangster was going crazy, he simply couldn’t understand how such a scary person could appear here!
Moreover, the means were far more cruel than he had imagined. He really felt that he would die if he didn’t say it.
“Wouldn’t it be better if you just said so earlier?”
Hodder asked with an impatient voice.
This bastard is totally wasting his time.
“Mr. Jin Bing is in an abandoned FBA warehouse in the suburbs. He…he has an important transaction there today.”
The gangster told all the news he knew in a wailing voice.
“Very good, you cooperate with me very well!”
The corner of Hood’s mouth rose, and he suddenly raised his hand and hit the gangster’s chin hard.
The gangster rolled his eyes and fainted cleanly.
In fact, it was not that difficult for him to get information from the gangsters.
After all, he possesses the power of the phoenix and can easily trick the other party into telling him what they know.
I just wanted to test Kabuto’s ability, so I just interrogated him in this way.
“By the way, how long are you going to stay up there?”
Hood stretched his shoulders and turned casually to face the five-story building in front of him.
The white figure leaped suddenly, flipped in the air, and landed lightly on the ground.
“How did you find me?”
Gwen looked at the mysterious man in front of her in surprise.
Although she had only been here for a short time, she moved very lightly and should not be discovered.
Besides.
She had great concealment skills, but this person had determined her position without even a glance.
“Maybe I’m just more sensitive to sound, Ms. Spider.”
Hodder chuckled softly and looked at Gwen carefully. “By the way, Ms. Spider, what are you spying on?”
“What do you mean by peeping? I’m just gathering information!”
Gwen awkwardly kicked the gravel around her feet with her right foot and asked, “Hey, Unicorn, if you’re going to find Kingpin, can I join you?”
“Why did you call me a unicorn?”
Hodder was surprised.
“Don’t you have a big horn?”
Gwen pointed to the large horn.
“I am a rhinoceros beetle.”
Huo De leaned against the car and asked lazily, “Aren’t you afraid that I’m a bad guy?”
The little girl is really bold. She actually plans to cooperate after just one meeting.
“Anyone who is Kingpin’s enemy is a friend.”
Gwen answered without hesitation, her voice full of determination.
“Do you have a grudge against Jin Bing?”
Hood really didn’t expect that the little spider in this world would become enemies with Kingpin.
“he……”
“So are you going or not?”
Gwen seemed to be hesitant to speak, but in the end she didn’t give a reason.
“Sure!”
Hood didn’t ask any more questions. He could hear the sadness in Gwen’s tone just now.
And he estimated that even if he didn’t go, Gwen would definitely go.
In a head-on battle, there is a high possibility that Gwen will not be a match for Kingpin.
If I remember correctly, Kingpin’s strength is enough to suppress Spider-Man in a head-on confrontation.
He came to the motorcycle, turned around and sat directly on it.
“Little Spider, come up!”
Hod waved to Gwen who was not far away.
“No, I…”
Gwen shook her head and was about to refuse when she heard Hodder say, “They are all low-rise buildings. Are you sure you can keep up with me?”
Hearing this, Gwen looked around Hell’s Kitchen…
Indeed, in Hell’s Kitchen, the idea of using spider webs to swing through is basically wishful thinking.
After much hesitation, he finally got on Hod’s motorcycle.
In the suburbs, outside an abandoned factory surrounded by trees.
The huge factory was filled with a faint yellow light.
From the outside, this looks like a lumber mill.
Despite the lack of light, one could still vaguely see many figures patrolling around the factory.
And each of them was equipped with a gun.
“Shh…”
Hod stopped his motorcycle far away and made a hushing gesture to Gwen who was standing beside him.
Then his right hand slid across the motorcycle, and a green snake pattern appeared on the back of his hand.
The motorcycle disappeared in an instant.
“Where’s the motorcycle?! Wasn’t it here just now?”
Gwen, who was standing by, almost popped her eyes out when she saw this scene.
The motorcycle was clearly in front of me just now!
And the most important thing is that she didn’t even feel any fluctuations.
Who the hell is this guy?!
“Why, are you curious?”
Hodder turned his head to look at Gwen and asked.
“certainly.”
Gwen nodded seriously.
If I also have this ability, my combat effectiveness will definitely increase by more than one level.
“If you want to learn, I’ll teach you later.”
Hood wanted to rub the cute little head, but finally resisted the urge.
“Teach me later?”
Although Hood was wearing a hood, his voice was different from his usual voice and sounded a little muffled.
But Gwen always felt that this sentence sounded so familiar.
“Where have I heard this before?”
Chapter 24: The terrifying defensive power of the suit! Shocked Gwen! (Old version)
“Don’t just stand there, follow me!”
Hodder interrupted Gwen’s thoughts.
Gwen nodded subconsciously and followed Hood’s footsteps quietly.
“Hush, Kingpin brought his elite troops here too.”
“He specially trained these people to clear obstacles for himself!”
The two of them hid behind an old, rusty container, and Gwen cautiously winked towards the distance.
As Gwen looked over, soldiers armed to the teeth, even with equipment comparable to that of a special forces squad, appeared in Hood’s sight not far away.
They are not only equipped with the most advanced bulletproof helmets and vests, but also wear bulletproof masks on their faces.
“King Bing is really rich!”
Hood couldn’t help but sigh in his heart, this set of equipment cost at least five or six hundred thousand.
But this actually directly equipped almost dozens of people.
“We have to be careful, they are not the same thugs as before…”
Gwen moved her hands and feet while observing carefully how to find the flaw.
She is indeed very skilled, but that doesn’t mean she is invulnerable.
In addition, they have undergone special training, so they have to be more careful.
But just as Gwen was speaking, the figure next to her suddenly stood up.
I saw that Hood actually walked out of the hiding place in the container and strode towards a place not far away.
“Hello!”
Gwen lowered her voice and whispered, “Unicorn, what are you doing?!”
She didn’t even know if this guy couldn’t hear her because he was wearing armor.
Going out like this is obviously seeking death!
“I’m going to test the performance of this combat suit!”
Hood didn’t even look back, and he moved his hands and feet as he walked.
Even though we just dealt with the thugs, there was no useful information at all.
If you want to know Kabuto’s true strength, you still have to play with these guys.
The moment Hood walked out, he was noticed by the elite soldiers in the distance.
“Call! There are alien intruders!”
When he noticed Hood walking over with confidence.
They did not open fire immediately, but reported the situation vigilantly.
After the news spread, teams from other directions immediately dispatched personnel to rush here.
In just over ten seconds, they had surrounded Hood.
Facing these soldiers, Hood slowly placed his hand on the Kabuto insect instrument on his belt.
“Masked form!”
He jerked the lever on the beetle head to the right.
【PUTON (dress)! 】
The Rhinoceros Beetle’s knight form changed at this moment.
Hod crossed his hands, and as the light flashed on the surface of the outer armor, pieces of steel armor covered the surface of the armor.
The single horn on its head was also retracted at this moment, turning into two forked steel horns.
The light appearance now becomes like a shield, and it seems indestructible just by looking at it.
The reason why Hood changes into this form is entirely because this masked form has strong defensive power.
Even if a missile hits your body head-on, it won’t be able to penetrate it.
“This looks absolutely stunning!”
Behind the container, Gwen carefully poked her head out and exclaimed with her eyes wide open.
There is simply no science and engineering student who can resist such a uniform.
And she couldn’t even see how it was done!
The elite soldier pulled the trigger without hesitation.
Flames shot up to the sky!
I saw bullets pouring out of the muzzle like raindrops.
Bullets rained down like a barrage of raindrops, covering Hood’s head.
Because of their training, their shooting is divided into alternating shooting.
The rapid sound of gunfire echoed in the sky without stopping for a moment, as if a dense string of firecrackers were being lit.
The bullet hit Hod’s masked armor, and broken fragments of metal collision burst out all over his body.
The burst of flames bloomed on the surface of the armor, just like fireworks exploding in the night sky.
The sound of steel clashing continued to echo around, and the soldiers did not stop pulling the trigger until they saw Hod fall.
Hod, on the other hand, observed the changes in Kabuto’s mask’s form with a calm expression amidst the hail of bullets.
It can be said that the bullets hitting their bodies were not even a tickle, because of the extremely thick armor. In his opinion, these people were just struggling in their death throes.
“This guy can actually handle these guys!”
Gwen finally let go of her worries.
Hodder stood there like a fortress that would never collapse.
I was obviously overthinking it.
In this situation, these guys have no influence on Hood at all.
“It’s my turn to perform!”
Gwen jumped out of the container nimbly, rolled over, and shot spider silk at the elite soldiers around him with both hands.
Sticky spider silk clung to the soldier’s mask, obscuring his vision.
Just as they were hurriedly trying to tear off the spider silk on the mask, they were greeted by a white figure.
The white arc rolled and jumped rapidly between the trees and obstacles, and the naked eye could only see the white figure in front.
Gwen shuttled back and forth quickly, and with Hood’s cover, she drew an arc in the air.
Falling behind the enemy, with wolves in front and tigers behind, the elite soldiers could not take care of themselves at all.
Inside the factory.
“Leave the North Coast matters to me. If we join forces, our business will surely spread overseas very quickly!”
The fat bald man sat on the black sofa, his suit sticking out high.
He supported his cane with his right hand and raised the wine glass in his left hand with a ferocious smile.
Da da da…
Just as Jin Bing was about to toast with the guests, there was a sudden burst of gunfire outside.
He frowned and turned to look at his men standing beside him.
“Boss, there are two intruders outside!”
His men quickly took out a tablet and called up the surveillance footage.
“Ghost Spider?”
Kingpin recognized the identity of the white figure immediately, “Who is this steely red figure? Iron Man?”
“Boss, this shouldn’t be Iron Man.”
The subordinate bent down and explained respectfully.
“no?”
“Let the doctor start Plan A and destroy them.”
Jin Bing finally let go of his anxious heart and waved his hand disdainfully.
After all, if Iron Man appears, maybe all the Avengers will come too.
But there is no need to worry about these two small fry.
“Mr. Jin Bing, is everything okay out there?”
The guest sitting opposite was visibly fidgeting.
“Don’t worry, it’s just a small trouble and it will be solved soon!”
Kingpin grinned and picked up the wine glass again.
Outside.
Hood stood calmly in the center of the battlefield, calling out names one by one with his pistol.
Simple strafing.
All the guards fell down one after another, and the blood flowing from their heads soaked the ground.
“Are you a scientist?”
Gwen spun in the air and landed next to Hod.
She was very curious about Hood’s identity. She often attended various scientific research conferences, but had no impression of this kind of scientific research results.
At first I thought it was an imitation of Iron Man, but it is clearly not the same type of armor.
“Go in quickly!”
Hood did not answer Gwen’s question and walked towards the factory.
“What is your armor made of? It’s definitely not ordinary metal, right?”
“Otherwise it would have been broken just now! Could this be vibranium?”
Gwen followed closely behind, continuing to ask questions.
She really couldn’t figure out who this person was.
Suddenly, the factory gate exploded.
More than twenty strange shadows appeared faintly in the billowing smoke.
Looking closely, they were clearly more than twenty robots with the appearance of mechas and spider legs on their backs.
These robots climbed up the wall quickly, and as they opened their mouths, you could even see the machine guns installed in their mouths!
“It’s Kingpin’s Spider-Slayer!”
Gwen’s expression became extremely ugly when she saw this scene. These robots were specially designed to target her.
It’s just that she had already solved those problems before, but she didn’t expect that it could be mass-produced!
Chapter 25: Time Boost, Super Acceleration, Everything is as if Still! (Old Version)
“It seems that Jin Bing really likes you. The cost of this thing should not be low!”
Hod didn’t care about these spider robots at all. Instead, he looked at the little spider beside him with a teasing look.
“Don’t be distracted! These guys are not easy to deal with!”
Gwen lowered her body, her expression beneath the mask was solemn, and her big eyes on the mask were frowned.
She had fought these things before, and they were superior in both agility and power.
Even in complex terrain, his reaction is comparable to hers.
A missile with a tail flame was actually launched from the bottom of the spider robot.
These twenty-plus missiles were like fireworks rising into the sky, and in a flash they arrived in front of the two of them.
Gwen jumped aside.
She never imagined that this was not just mass production, but that missiles were even installed.
Facing the flying missiles, Hood casually grabbed a missile that was flying towards his face.
The other missiles exploded directly on Hood’s body like a rainstorm.
With the continuous loud noises, the place where Hood was was covered by continuous flames.
The surrounding ground was lifted up by the powerful missile, and loose soil flew in all directions.
Looking from the sky, it looked like a mushroom cloud rising.
The terrifying power even turned the surrounding land into a charred black color.
Even the debris around was blown away by the terrifying power.
“!!!unicorn!”
Gwen’s pupils trembled violently. The comrade who had just fought side by side with her was killed by the missile attack!
She felt a little suffocated when breathing, she never expected it to turn out like this.
“ignorance!”
Jin Bing in the factory looked at the screen on the tablet and drank the wine in the glass.
Faced with such concentrated missiles, even the so-called superheroes would not be able to stop them!
The missiles installed here are all the top-notch military missiles previously sold by Stark Group!
However, as the thick smoke slowly dissipated, a burly figure stood there motionless, bathed in the remaining smoke.
The surrounding land was turned into scorched earth, but there was not even a trace of damage on the surface of the mecha.
“This armor is quite tough.”
Hood stretched his body and felt no pain or soreness, not even an itch.
Just now I was a little worried whether this armor would not be able to hold up.
Unexpectedly, even more than 20 missiles only caused him to tremble slightly.
“Damn it! How is this possible!”
Jin Bing subconsciously let go of the wine glass, and the deep red wine spilled onto his lining shirt.
But he ignored all this and looked at the picture above with a ferocious expression.
“Mr. Jin Bing, otherwise… I’ll leave first!”
The guest sitting opposite looked hesitant and was ready to leave.
He was just here to do business and had no intention of risking his life here.
“Don’t worry, there will be no problem!”
Jin Bing spoke in a hurried tone to win back the client, and at the same time turned to look at his men and shouted: “Kill him! Kill him for me!”
He had faced so many enemies, but this was the first time he felt so ashamed.
His client was clearly right across the street, but he couldn’t even deal with a small character of unknown origin!
As Kingpin’s order was given, more than twenty spider robots immediately divided into two teams and pounced towards Hod and Gwen.
Whoosh whoosh whoosh!!!
The moment the spider robots surrounded them, the spider legs on their backs were like sharp spears, breaking through the air and attacking the two of them.
With the support of the engine, these spider legs contain enormous power, and each time the power is no weaker than armor-piercing bullets.
“Be careful, these guys’ data models have been equipped with the combat skills of those combat masters!”
“It even has a simple artificial intelligence chip installed inside that can handle all kinds of attacks!”
Gwen, who was quickly dodging the spider robot’s pursuit, did not forget to give a reminder.
It was as if Hood could see all the scenes around him and he easily avoided all the attacks from the spider legs.
He even calmly grabbed one of the spider’s legs and broke it with his elbow.
There was no panic in his every move, and his manners were even somewhat elegant.
Gwen turned her head to avoid one of the spider legs, and her head was buzzing when she saw this scene out of the corner of her eye.
Who on earth is this guy? He can even use his fighting skills to fight back at this time!
“I’m afraid only someone like Tony Stark can be compared to such an outstanding person!”
She couldn’t help but sigh in a low voice, this technique is really too powerful!
Although on the surface it seems to be just a simple dodge, every step and movement has the shadow of different fighting.
Wing Chun, Babo, Bagua, Muay Thai, Boxing, Judo, Joint Techniques, etc.
And each of them must be of the most advanced quality before they can be integrated and used together!
Hod used an Eight Extreme Blast to blast the nearest spider robot away.
“Don’t these spider robots have any other tricks?”
He moved his wrist, and there was a hint of impatience in his eyes.
If I didn’t want to see the performance of these spider robots, I would have dealt with them all long ago.
After all, in terms of fighting, if he says he is second, no one would dare to say he is second.
There are probably few people in this world whose fighting skills are better than mine.
Buzz buzz buzz!!!
At this moment, the spider robot in front of him exploded.
The silver machines quickly reorganized in the air, transforming into nearly a hundred mechanical spiders.
Although they were smaller in size, their numbers were rushing towards them like a tide!
“They’re split!”
Gwen warned loudly, about to deal with the spider robot in front of her.
But he was shocked to find that these spider robots turned around and rushed towards Hood.
Her expression became extremely ugly. Although the rhinoceros beetle had strong defensive capabilities, it was no match for so many spider robots!
What’s more, in this situation, no matter how powerful your fighting skills are, they will be of no use!
“It seems that this old guy Jin Bing is a bit tired of playing!”
Hodder looked at this scene and couldn’t help but complain in his heart.
He put his hand on the belt and yanked it to the right.
【CAST?OFF (Armor Explosion)】
A sound effect sounded.
The heavy armor on his body exploded!
The shattered fragments flew towards the mechanical spider group like dense raindrops.
Hod pulled the rhinoceros beetle horn on his belt again.
【Time-up sound effect】
The spider robot that was lifted into the air suddenly slowed down its falling speed.
Even the air around them almost froze.
Not far away, the same thing happened to Gwen who was supporting them from the air.
The wind-blown grass blades also swayed at a packed speed.
“Is this the rise in time?”
Hod looked around as if everything was still, with a hint of enlightenment in his eyes.
It’s like slowing down time.
“No! To be precise, my speed has increased!”
“And the reason they can’t see it is because I am now moving at a super speed that is unrecognizable to human eyes!”
After thinking it all through, his pupils contracted rapidly.
“It seems that we should solve these troubles around us first!”
Hood twisted his body and walked slowly among the spiders.
Whenever you pass a mechanical spider, quickly tap on it.
At this time, the exploded fragments were flying in all directions at an almost stagnant speed.
【End of the time-up】
All robots explode!
? !!!!
Gwen’s expression changed drastically while she was in the air.
“What’s going on? Why did everything explode suddenly?!”
I thought to myself that I didn’t even blink, and that red afterimage…
Inside the factory,
“Why did it suddenly explode?!”
“Is this the speed this mecha can reach?!”
Jin Bing’s eyes widened, and even his breathing became rapid! This was the only thought left in his mind!
But how could he not know about this when he has such technology?
Could it really be Tony Stark?
This guy just changed into a new battle uniform? !
Chapter 26 It’s so big, stop stroking it, I have something bigger! (Old version)
The exploded mechanical spider fell to the ground, with steel fragments scattered everywhere.
“Unicorn, your suit can also speed up?!”
Gwen quickly came to Hood’s side and looked at Hood’s armor with envy.
My eyes are almost full of stars.
I couldn’t help but stand on tiptoes and rub the big bright red horn.
Hodder watched her standing on tiptoe, so he simply lowered his head to give her a more comfortable rub.
“What is the principle behind this?”
Gwen had more fun noticing the detail of Hodder lowering his head.
This armor is so cool, and it can be played like that!
And this big bright red unicorn horn feels so good to the touch (????)??!
It can be said that everything that happened tonight shocked her.
No…
To be exact, it should be like this all day long.
After all, Mr. Hood whom I met today was also very mysterious.
“Have you touched enough?”
Hod turned his head slightly and patted Gwen’s little head gently: “We should go out and find Kingpin!”
“Yeah, I just feel it feels good to touch!”
Gwen reluctantly withdrew her hand, after all, this thing was too cool.
It had clearly been bombed by missiles, but its surface was still incredibly smooth.
“There will be bigger ones for you to touch later!”
Hodder smiled mysteriously.
“What? Do you have any other armor?”
Gwen’s eyes widened and she looked at Hod with excitement.
She really didn’t expect that there were other armors.
…Pure little Gwen!
Hood did not answer the question and walked into the factory first.
As soon as I walked in, a smell of medicine hit me in the face.
“Ouch, it stinks! What the hell are they doing in there?!”
Even though she was wearing a hood, the smell still made Gwen cover her nose.
“It looks like they have a huge trading volume tonight!”
When Hood smelled the smell, he instantly understood the purpose of this warehouse.
This appears to be an abandoned factory, but it is actually where they store their goods.
And judging from the boxes around, it is estimated that the entire warehouse is full of these goods.
At this moment, a loud noise suddenly came from behind.
Even the ground beneath my feet was shaking slightly with this loud noise.
Looking back, I saw that the damaged warehouse door was actually blocked by a thick iron plate!
Judging from the device above, this should be a thickened iron plate specially made to resist foreign enemies.
The so-called warehouse door is just a decoration, the real defensive measure is this iron plate.
Thump thump thump…
At this moment, the dim factory suddenly became as bright as day, and the chandeliers above were suddenly turned on.
“You two, welcome to my wood factory!”
Following the sound, I saw a tall and strong figure slowly walking out from the corridor on the second floor, with a cane in his hand.
When he walked out, a group of people suddenly rushed out from other places, all pointing weapons at Hood and Gwen.
“Kingpin!”
The moment Gwen saw Kingpin, there was unspeakable anger in her voice.
Hood, who was standing by, could clearly feel Gwen’s mixed emotions.
“Little guy, we are really destined to meet each other. I have come all the way here and I still meet you!”
Jin Bing slightly hooked his finger towards the side, and the men beside him immediately handed him a cigar and helped him light it.
“I came here just for you!”
Gwen yelled through gritted teeth.
Little Gwen’s hatred…
Hod sensed Gwen’s deep hatred for Kingpin.
“Coming for me?!”
Kingpin took a deep puff of his cigar and shifted his gaze to the red and silver figure, his eyes filled with anger: “If it weren’t for your friend, you would have died long ago!”
He really didn’t expect that someone would specifically help this damn little spider.
“If I had come earlier, you would have died earlier.”
Hodder’s voice was calm, even with a hint of disdain.
This is also because he had not heard of Jin Bing’s appearance, otherwise he would have taken action long ago.
“Yeah?”
Jin gritted his teeth and looked at Huo De with fear: “My friend, there is no grudge between you and me, why do we have to hurt the harmony!”
“Are you trying to bribe me?”
There was a hint of teasing in Hodder’s tone.
“No!”
Kingpin smashed the cigar to the ground hard, sparks flying everywhere.
He supported his body with his left hand, flipped over suddenly, and jumped down from the second floor.
The moment that huge weight hit the ground, there was even a dull thud.
“Even if I die, I will never surrender!”
After saying that, he slowly took off his suit jacket and grabbed the shirt on his chest with his right hand.
He tore the wine-stained clothes with a sudden force and threw them aside.
All I could see under the clothes was an extremely muscular body.
“I have ambition.”
Hood nodded appreciatively. He really admired Kingpin’s courage.
Otherwise, he wouldn’t have fought his way out of the mixed crowd of Hell’s Kitchen and become the underground emperor who dominated one side.
“Come on! I want to see how strong you are!”
Jin Bing showed a ferocious smile and his breathing became heavy at this time.
“careful……”
Gwen wanted to remind Hood to be careful, but when she thought of the armor on Hood, she swallowed the words that were about to come out of her mouth.
After all, with this level of strength, it’s not certain who can be asked to pay attention to safety.
“In that case, I will also take off my armor and fight you fairly!”
Hodder strode forward, his voice lazily voiced.
He did that for two reasons.
The first is to admire Jin Bing’s bloodiness.
Secondly, it may trigger a reward.
After all, the one who was defeated was the underground emperor.
“What?!”
Gwen’s head was buzzing.
She simply couldn’t understand why Hood would give up his advantage.
Obviously, his biggest advantage is the armor he is wearing.
He actually wants to fight the underground emperor?! Is there something wrong with his brain?
You have to know that Jin Bing’s frontal power is greater than hers, so she can’t be sure of winning even if she goes up.
This man who relies on armor actually plans to take off his armor? !
“This guy wants to fight the boss in physical combat?! Hahaha!”
“I guess this guy’s head is full of cheese!”
“Are you tired of living and come here to entertain our boss?”
“It looks like we’re safe this time!”
Jin Bing’s men were also whispering to each other, with disdain in their eyes.
But they knew how terrible their boss was, and they were no match for him even if they attacked him together.
If the man was wearing armor, it wouldn’t be certain, but if he took off the armor, they would be safe.
Jin Bing was overjoyed. The reason why he was afraid of Hood was entirely because of his battle suit.
But without the battle suit, it would be hard to say who would win. He sneered and said, “I didn’t expect you to be such a man of blood. If you beat me, our relationship will be written off.”
“good!”
Hodder nodded slowly, turned back to Gwen and said, “Spider-boy, stay out of this, I’ll put on a good show for you!”
Gwen got anxious when she heard this: “This is Kingpin! Are you crazy?”
“You’ll soon find out whether he’s crazy or not, but it’s still unclear who’s stronger and who’s weaker.”
As Hodder said this, he put his right hand on his waist and directly pulled open the insect instrument.
The buzzing sound was loud.
The bright red battle armor on his body fluttered away, and a rhinoceros beetle flew away with it.
Under the light, it looks extremely dazzling.
And as the mask disappeared, Hood’s handsome profile also appeared.
“This guy…”
The large eyes in Gwen’s mask widened.
This person…
It’s actually Hod!!!
Chapter 27: It was actually Hod, who defeated Kingpin with one serious punch! (Old version)
“You are Mr. Hodder!!!”
Gwen was shocked. At this moment, she finally understood why she felt this mysterious man was so familiar.
Because the mysterious man in front of her was Hood, so he said he would teach her.
“So this person is Mr. Hodder. No wonder he is always so calm.”
Gwen thought to herself as she looked at Hodder’s figure.
If it’s Mr. Hodder… then he’s sure to win.
She felt her ears burning when she thought that she had actually persuaded Mr. Hood not to be impulsive.
wrong!
It’s Hood who should be blushing!
He had known all along, but had never revealed his identity.
He even pretended to be so cool and aloof. She was fooled!
“Hod Fernandez?”
When Jin Bing saw the man’s appearance, his brows furrowed, and even the flesh on his face wrinkled together: “If I remember correctly, you are a member of the board of directors of Stark Group!”
He has a certain understanding of the information of these senior executives, and the members of this board of directors are either rich or noble.
“Well, I seem to have such an identity.”
Hodder nodded and grinned: “Of course you can also call me a brave climber, a pentathlon champion, a philanthropist, or something like that.”
After he owned shares in the Stark Group, he did have such an identity.
It’s just that he never attends such meetings.
“Mr. Hodder, I don’t think we need to be so awkward…”
Jin Bing actually made concessions at this time.
Because he knew very well that if he killed anyone from the Stark Group, he would be in real trouble.
If there is any problem with the identity and status of these people, it will inevitably cause an earthquake.
What’s more, Tony and the Avengers are not easy to deal with. He doesn’t think he can deal with those monsters.
So if possible, we would rather give up some profits in exchange for Hood’s departure.
“No! But don’t be afraid of my identity.”
Huo De shook his head slightly and said with contempt: “I just want to beat everyone present to death, or be beaten to death by everyone present!”
“You’re going too far. Don’t think I’m afraid of you!”
“In that case, don’t blame me for being ruthless!”
There was murderous intent in Jin Bing’s eyes. It was the first time he encountered such provocation.
As an underground emperor, he is actually looked down upon by others.
Even if the Avengers are behind him, he will never let this person go.
and…
As long as Hood disappears, no one will ever find him!
“bring it on!”
Like a gentleman who specialized in etiquette, Hood did not forget to roll up his white sleeves and slightly hooked his finger at Kingpin.
That disdainful look made Jin Bing so angry that his muscles were shaking slightly.
“It’s going to be a good show!”
Gwen shot out a spider silk and hung herself upside down on the roof to watch the show.
She was indeed worried about Hood before, but after knowing Hood’s identity, she no longer cared about him at all.
Jin Bing has met a tough opponent this time, and he deserves his bad luck.
Mr. Hood can control the lizard people at will.
Kingpin leaned forward slightly and assumed a sumo stance, staring at Hood with serious eyes.
This is his best fighting style, because of his huge weight, he can better suppress the enemy through sumo.
Hood looked at Kingpin with disdain, his hands behind his back, as if he didn’t take Kingpin seriously at all.
“Damn it! You’re going to die!”
Jin Bing became furious when he saw the arrogant look.
In an instant, the ground beneath his feet suddenly cracked.
He leaned over and rushed towards Hod, and his speed was so fast that only a flesh-colored shadow was left.
It was like a heavy tank rushing towards Hod at the fastest speed.
Every time he took a step, the floor of the entire warehouse shook slightly.
“soon.”
Hod nodded slightly and had to admit that Kingpin’s speed was beyond the limits of normal people.
If it was an ordinary person, they wouldn’t even be able to react to this speed.
Moreover, Kingpin is very heavy, and it is incredible that he can reach such a speed with such a heavy body.
Because the greater the force applied, the greater the force endured!
Trying to stay flexible would put the body under greater pressure, but Kingpin doesn’t seem to have this worry.
but……
This is only for others.
It was not even good enough in front of him, and there was no way to cheer him up.
Facing Kingpin’s charge, Hood suddenly pulled his body to the side when the opponent was about to pounce on him.
The golden man passed right by him.
“I didn’t expect you to react so quickly!”
The Kingpin stopped after missing his target and turned to look at Hood.
I have to say, the distance just now was just a few centimeters, which was enough to knock Hood away.
At his speed, even the slightest contact would be like being hit by a truck.
However, he was also keenly aware that Hood must be a martial artist.
It is absolutely impossible for an ordinary person to have such speed.
But even so, he is definitely no match for me.
Just as he was thinking, Hood on the opposite side suddenly took action.
His movements were so fast that one could barely see his afterimage.
“drink!”
At this critical moment, Jin Bing hurriedly used his arms to block, and the huge force from his arms made his eyes widen suddenly.
this!
What kind of power is this!
Before he could react, he was swept away by the huge force.
The moment he hit the wall, the blood in his body surged and he instantly turned red.
“What kind of monster is it that can kick the boss away!”
“Can this still be considered human?!”
Jin Bing’s men were all dumbfounded.
They had never seen their boss become like this after just one move!
“As expected, your boss is probably going to lose.”
Gwen was not surprised, after all, this was Mr. Hodder!
She has now even focused on why Mr. Hood is “playing tricks” on her.
“you….”
Kingpin felt a sharp pain in his arms as if they were being torn apart, and he looked at Hood in horror.
The force just now was very strong, far exceeding that of the ghost spider!
Even his intuition told him that the other party had not yet used his full strength.
As soon as Hood’s voice fell, his figure appeared in front of him.
With strong wind, his toes kicked Jin Bing’s chest quickly, accurately and fiercely.
Jin Bing’s pupils shrank into needle points in an instant, and he gritted his teeth and raised his hands.
The kicks came out like a string of cannonballs, as fast as afterimages and a sudden downpour.
There was no chance to breathe at all.
It only took less than a second.
Jin Bing felt severe pain in his arms, as if they were hit by countless sledgehammers.
But soon, the arm lost feeling and endless blood flowed.
The white bones are exposed in the air!
His arm is broken!
thump!
Jin Bing was panting and fell to his knees on the ground powerlessly.
“I…I lost.”
He had never seen such a terrifying opponent.
This is no longer a battle, it can even be called a massacre.
He failed before he even touched the corner of Hood’s clothes.
[Ding! You successfully defeated Kingpin in a one-on-one duel! ][Reward: Serious Punch! ]“The winner is the king, the loser is the bandit, and the loser must pay the price.”
Hood listened to the system prompts in his mind and had no intention of letting Jin Bing go.
He grabbed Jin Bing’s head and slowly lifted it up.
The winner takes it all.
What’s more, Jin Bing had murderous intentions towards him.
At this time, Kingpin’s limbs were hanging limply, even though he was terrified to the extreme.
But his body just wouldn’t listen to him.
“Mr. Hodder, could you please not kill him?”
But at this moment, Gwen let go of the spider silk, jumped down from the roof, and opened her mouth to stop it.
“What?”
Hodder looked at Gwen with surprise.
Doesn’t Gwen hate Kingpin?
Kingpin never thought that it would be Ghost Spider who pleaded for him at this time.
Hearing this, he breathed a sigh of relief. As long as he could stay alive, he would definitely have a chance to come back!
But Gwen’s next words surprised Hood greatly.
Gwen took a deep breath and said through gritted teeth: “Let him lie in bed for the rest of his life as a vegetable.”
Chapter 28: Love and hatred, Gwen forcefully kissed! (Old version)
But this is not a problem for Hood at all.
If nothing unexpected happens to Jin, he will spend the rest of his life as a vegetable.
The sturdy man, covered in wounds, leaned against a broken pillar, with only emptiness in his eyes.
“Call 911 for your boss,”
“Then I will deliver the things in these warehouses to surrender myself.”
Hood withdrew his hand and turned back with a calm expression to look at the thugs who were terrified to the extreme.
When their eyes met, the thugs nodded without hesitation.
Just now they saw a scene that would make them live in fear for the rest of their lives.
“Let’s go!”
Hood glanced at Kingpin lying motionless on the ground, and took Gwen out of the warehouse.
No one dared to stop this action.
Who could have thought that in just one night, the emperor of the underworld would disappear forever.
All there is is an insignificant vegetative state.
Under the moonlight, the moonlight spread on the ground like silver frost.
At first glance it looks like it is covered with a layer of silver frost.
On a small hill in the suburbs, the white moonlight enveloped the hill.
Gwen sat on the sharp cliff at the top of the mountain and looked up at the moon.
She didn’t say anything, just stared at the bright moon in a daze.
“You hate Kingpin?”
Hodder walked over to sit next to Gwen and asked.
He could see that the moment Kingpin appeared, Gwen’s hatred had reached its peak.
He even wanted to tear Kingpin into pieces.
Besides, Gwen’s personality is definitely not that extreme.
And this time, it can be seen how much Gwen hates Kingpin.
Gwen nodded slightly and pulled off her hood.
The moment the hood was pulled open, the light golden hair fell down.
Under the moonlight, it looks like a flowing Milky Way.
The high nose tip makes the face even more charming.
The fair skin looks like white jade when viewed up close.
Under the reflection of the moonlight, it exudes a crystal clear luster.
Her face had clear and soft features, a high nose and tight lips.
It exudes a temperament of perseverance and courage.
Gwen has always been very concerned about her identity, so it will not be easily known by outsiders.
I didn’t expect Gwen to take off her hood in front of me.
And, this face is beautiful…
It is like an orchid under the moonlight, with an elegant temperament and a bit of tenderness and charm.
Compared with Wanda, they are completely two extremes, but this does not affect Gwen’s beauty at all.
“Surprised?”
Gwen smiled and turned her head to look at Hod: “Aren’t you not wearing a mask too? It would be very rude for me to continue wearing it.”
Hodder stared at the charming face and nodded subconsciously.
It must be said that Gwen’s beauty had far exceeded his expectations.
“My father is a policeman. More than two years ago, when he was on duty, he caught a wanted criminal, offended Jin Bing, and was beaten severely.
It has been more than two years and he is still lying in the hospital and has not woken up. “
Gwen looked dimly at the blooming city in the distance.
It is also for this reason that she hates Jin Bing so much.
If that hadn’t happened…
She may not be Spider-Man, but a girl next door.
“So, you want Kingpin to suffer the same pain…”
Hood didn’t expect that Gwen’s family in this universe was equally miserable.
It is probably because of this reason that he has been chasing Jin and won’t let go.
For Gwen, this will probably be a lifelong shadow.
He remembered that Gwen’s father, Mr. George, was indeed a policeman.
A just, brave, helpful and motivated police officer.
But he turned into a vegetable.
This feeling is simply worse than death!
Even this hope was like a string hanging on Gwen.
Because she herself didn’t know whether her father had any chance of waking up.
“For someone like Kingpin, it’s obviously more terrifying for him to be an interesting vegetable than to die,” Hodder said.
“I’ve been tracking this down, so I’ve been looking for trouble with Kingpin.”
“But he is too strong and powerful. No matter what I do, I seem so weak.”
Gwen shifted her gaze to the moon and nodded slightly, a light flashing in her eyes.
What she had been insisting on was finally completed at this time.
“But you achieved your goal.”
Huo De took a deep breath, forced a smile and spoke to comfort him.
This is also a poor man, who is always on the road for hatred.
Never stopped.
“Yes…but it seems that it has not been realized.”
Gwen lowered her head and sighed, “Father is still lying in bed. He will never wake up.”
Although she said she had completed it, what followed was emptiness and despair.
The girl had a sad face and tears were streaming down her eyes, but she quickly wiped away the tears with the back of her hand.
She didn’t want to show her vulnerable side in front of others.
Suddenly, a big hand held her tender white hand: “No! Your father has a chance to wake up!”
“Do you have a solution?”
Gwen raised her head suddenly, blinking her eyes with hopeful tears: “Do you have a solution?”
There is always a shroud of mystery around this man. Perhaps he really has a way.
“Tomorrow morning, we will go to the hospital to visit your father. I will arrange everything then!”
Hodder nodded affirmatively.
He has a horse charm, which can cure all diseases.
And Gwen’s father will surely get better.
“Then tomorrow!”
Gwen did not struggle to break free from Hod’s big hand, but instead raised a bright smile.
Her sixth sense told her that she could trust the mysterious man in front of her.
And when she is close to a man, she always feels at ease.
The other party is trustworthy.
Huo De took the initiative to let go of his hand and stood up, saying with a smile: “Okay, then, I’ll be there tomorrow night.”
Gwen nodded with a shy smile, looking so charming in the moonlight.
Hodder got on his motorcycle and took Gwen to the downstairs of her house.
“Give me your phone!”
Gwen got off the motorcycle and took the initiative to ask.
Hodder was naturally happy to exchange numbers.
“I’m going back first.”
Gwen said, shaking the phone with the number saved on it.
“Go ahead!”
Hodder waved his hand.
But at this moment, Gwen seemed to muster up the courage, took a step forward, and a soft touch was imprinted on Hood’s face.
Huo De’s eyes widened suddenly. He didn’t expect that…
“I’m going back! See you tomorrow!”
Gwen pulled back and trotted back to her quarters.
Hod touched his cheek and watched the figure disappear among the tall buildings.
I was actually kissed by the little girl!
It would be a pity if those soft lips were only used for kissing the face…
Chapter 29: Wanda’s crimson translucent nightgown, the healing power of the horse charm, and a dinner date! (Old version)
[Serious Punch]: Saitama’s serious punch splits the earth in half, ignoring any physical or magical defense. Each time it is released, the cooldown period is 365 days!
Inside the large white bed in the manor, Hood opened his arms and watched the system’s introduction of rewards comfortably.
“Saitama’s serious punch?”
Looking at the newly acquired reward, he nodded slightly subconsciously.
He knew that this reward was Saitama’s unique skill, but he never expected to get such a BUG reward.
I estimate that with one punch, almost no living creature above the surface would be able to resist.
“It’s a shame this is the equivalent of a one-time thing.”
Hod breathed a sigh of relief. Although there was a cooldown, the cooldown time was a bit too long.
He shook his head to get the matter out of his mind.
Anyway, we have a system, so it’s only a matter of time before it becomes stronger.
[Ding Dong! ]The cell phone on the brown bedside table vibrated.
Huo De picked up the phone casually, and when he saw the message on it, the corners of his mouth couldn’t help but rise.
Because this was actually a message from Wanda!
【Wanda】: Are you asleep?
In Scarlet Witch’s room at Avengers Base.
Wanda was lying on the bed wearing a crimson translucent nightgown.
The bright red fabric couldn’t hide the fair skin at all.
The hemisphere of the earth was squeezed, and Wanda tossed and turned on the bed.
Whenever she closed her eyes, the haunting figure appeared in her mind.
So much so that she couldn’t help but search for news about Hood on the Internet.
I couldn’t help but smile when looking at the photo above, and my feeling of missing you grew stronger.
It had only been a short time since they separated, but she felt as if the days had passed so slowly.
After hesitating for a long time, she took out her cell phone and gritted her teeth to send a text message to Huo De.
At this moment, she seemed like a little girl, afraid that Hood would not reply to the message.
【Hodder】: What’s wrong? Did you miss me?
The moment this message popped up.
Wanda’s body tensed up, and the corners of her mouth couldn’t help but curve up.
It was the first time that she felt so happy after receiving the news.
[Wanda]: Can’t I send you a message even if I don’t want to?
Wanda stared at the screen, her fair feet swinging constantly.
When Hood saw the message, he laughed out loud. He finally realized that the little witch had fallen!
[Hodder]: Cute little witch, do you want to have breakfast?
“breakfast?”
Wanda was stunned at first, then suddenly remembered what Hood had said that morning, and her face turned red.
【Can you be more serious! 】
She typed quickly on the keyboard. Although she replied like that, she did not resist in her heart.
Because only at that time would she feel the communication between hearts.
She herself knew that she could no longer help but become dependent on Hood.
To be honest, she herself couldn’t believe that she would fall in love with someone so quickly.
Even though I know it’s wrong, I still want to get closer.
[Hodder]: When you are free, let’s go and celebrate together that you have finally gotten rid of that damn public opinion.
Wanda could no longer contain her joy, and her little feet shook even more violently.
At this moment, she no longer looked like the nearly invincible Scarlet Witch, but a little girl.
[Wanda]: The day after tomorrow night, shall we go out for dinner together?
Wanda quickly tapped on her phone’s keyboard and sent the message out.
The reason why she chose the night after tomorrow was because she had a press conference tomorrow that she needed to attend.
Otherwise she wouldn’t want to wait even a moment.
[Hodder]: No problem. See you the day after tomorrow, my little witch.
“yes!”
Wanda clenched her fists sharply and let out a cry of surprise.
The day after tomorrow, she will be able to see Hood.
After taking another look at Hood’s photo, she reluctantly put her phone aside.
But unlike before, she fell asleep contentedly.
Should I confess my true feelings to Hod?
This was Wanda’s last thought before she fell asleep.
On the other side, Hood also put down his phone at this time.
I’ve been busy all day today, it’s time to take a good rest.
He promised to accompany Gwen tomorrow to visit his father.
The next day, early morning.
Ding Dong~
The copper bell on the oak door of the English-style coffee shop on the street in New York City rang slightly.
A familiar figure appeared in the store.
“Hodder, my dear old friend, I miss you so much!”
Uncle Kru, who was wiping the table, saw Hood appear and greeted him happily.
“Uncle Crewe, I think you don’t miss me, you miss the money in my pocket!”
Hodder sat down in a familiar chair, smiled and started to tease.
“How can you say that? I think you are a very interesting person.”
Although Uncle Crewe was deeply troubled by what he said, he still waved his hand and continued, “What would you like to drink today?”
“Let’s keep it the same as before.”
Hodder said casually.
After a while, Uncle Crewe placed the Blue Mountain coffee in front of Hod.
The TV hanging on the wall was playing a news report.
【Last night, someone reported that the underground emperor Jin Bing was beaten and seriously injured! 】
[At present, our station is still paying attention to this incident! ]“The media today is really bold. They even dare to spread rumors about Kingpin. Is there anyone in New York who dares to touch Kingpin?”
Uncle Kru stroked his dense beard and cursed angrily.
“The Underground Emperor…”
Hodder glanced at the news and turned his attention back to the swirling coffee.
“You also think it’s unreasonable, right?”
Uncle Crewe returned to the front desk and laughed loudly.
Hood smiled and didn’t say anything, but looked out the door from time to time.
He didn’t stop stirring with the silver spoon until a beautiful figure appeared from the window.
jingle!
As the oak door was pushed open, sunlight poured into the store and that energetic figure walked in.
This person full of youth and liveliness is Gwen.
She was wearing a British-style light white plaid coat and quickened her pace as she came in front of Hodder.
The wind was mixed with the scent of orange perfume.
“Mr. Hodder.”
Gwen raised the corner of her mouth and greeted Hod.
“You look so beautiful today!”
Hodder was amazed by Gwen’s dress and did not hesitate to praise her.
“Thanks.”
Meeting Hood’s direct gaze.
Gwen put her hands behind her back nervously, her mind full of yesterday’s scenes.
She was just hot-headed yesterday and acted boldly.
“Uncle Crewe, give me a cup of Bond coffee!”
Hod shouted at Uncle Crewe, then looked at Gwen with a smile: “Sit down first, the coffee here is delicious!”
As a veteran in the world of love, he knew very well that in many cases he should not ask, but just make the decision himself.
This can further enhance the male’s charm.
Gwen carefully sat down opposite Hodder.
“You weren’t so reserved yesterday. You were much braver than you are now.”
Looking at Gwen’s expression, Hodder couldn’t help but make a teasing remark.
Gwen’s face flushed instantly. She looked at the coffee that was served and quickly picked it up and took a sip.
But he was so burned that he couldn’t help but gasp.
She lowered her head. After all, she knew that she was too impulsive.
Although Hodder is indeed handsome, it is really offensive to do so.
“I won’t tease you anymore. After we finish our coffee, let’s go to the hospital to visit Mr. Stacy.”
Instead of continuing to tease Gwen, Hodder got down to business.
“Then… the instruments and equipment…”
Gwen had just noticed that Hod didn’t bring any equipment with him.
“No equipment needed, just go check it out first!”
Hodder shook his head.
“Just going to take a look?”
Gwen felt a little disappointed. She thought Hood had the skills to treat her father.
Because Hod brought her too many surprises…
Saint John’s Hospital, Queens.
This is the best hospital in Queens, and people come and go here every day.
“Gwen! This way!”
As soon as they arrived at the hospital corridor, Gwen’s mother Helen called out to Gwen. She had been waiting here early today.
“mom!”
Gwen quickened her pace and brought Hod to Helen.
Helen looked at the young man next to Gwen and asked, “Who is this?”
“Mom, this is Mr. Hodder!”
Gwen quickly introduced Hood. She had told Helen yesterday that she would bring someone to help her father see the doctor today.
“he?”
Helen looked Hood up and down with a slightly strange expression.
This guy doesn’t look like a doctor, he is too young and very noble.
“Mom, let me take Huo De in to have a look first.”
Gwen quickly pulled Hood in and explained, “Don’t mind. My mom is worried about my dad.”
Hood didn’t take it to heart, but looked at the figure on the bed.
George looked pale and appeared to have been unconscious for a long time.
“He has been in a coma for more than half a year.” Gwen’s eyes couldn’t help but turn red.
Helen, who followed in, hugged Gwen and asked, “Do you think he can wake up?”
“Uncle’s condition is very bad. Normally, he may not wake up in the future.”
Hood made his judgment after just two glances.
These words made the mother and daughter pale and extremely sad.
He changed the subject, “But…”
There was a faint light flashing on Hood’s palm, but this detailed movement was not noticed by the two men.
But in the next second.
“Cough cough cough!!!”
George on the bed suddenly coughed violently. His eyes suddenly widened, and he gasped for breath with a look of confusion on his face.
Seeing this sudden scene, the mother and daughter were stunned at first, and tears immediately welled up in their eyes!
“dad!”
“Honey!”
Gwen and Helen rushed over and hugged George with tears in their eyes.
Hodder stood back with a smile on his face, watching the family reunite.
And the horse rune flickered on his palm.
P.S. Brothers, if you think it’s good, please give the author some free flowers. I’ll be very grateful. If one person gives me flowers, no matter how many flowers I give, I will add another chapter.’
The third chapter is in the small dark room and has not been released yet. You can go back and read it in two days.
That one was probably too explosive, so we revised it four times.
Chapter 30: Wanda and Gwen’s dinner invitation? A real man wants them all! (Old version)
Outside the ward.
Gwen choked up with tears in her eyes and said, “Hodder, thank you…”
She never dreamed that there would be a day when her father would wake up.
Moreover, after the doctor’s diagnosis, it was found that this was not just awakening.
Even the muscles that had atrophied due to long-term bed rest have recovered, and his physical features are even healthier than before.
After subsequent confirmation, you can be discharged directly from the hospital.
Even doctors call it a medical miracle.
This has never happened in the medical field!
“You’re welcome. It’s your father who’s lucky. I didn’t do anything.”
“I know it’s you!”
Gwen’s nose was red.
She knew very well that this was not a miracle, because her father only woke up after Hood came here.
Although she wasn’t sure how this was done, she knew it was all thanks to Hood.
She said naively, “Are you free tomorrow? I’d like to invite you to dinner.”
The girl added, “This is my father’s way of expressing gratitude to you. When he gets used to it, we will arrange a more grand banquet to thank you.”
“tomorrow?”
Hood was stunned for a moment, and a plump figure in red popped up in his mind.
It doesn’t matter whether Gwen’s parents treat or not, as long as Gwen treats.
But…I have an appointment with Wanda to have dinner tomorrow night.
But if I reject Gwen, I might miss the best opportunity.
“Are you free tomorrow?”
Gwen keenly noticed the conflicted look on Hood’s face: “I would also like to thank you tonight, but my father…”
Because follow-up examinations are still needed, she simply cannot spare the time.
“no problem.”
After a moment, Hood nodded with a bright smile.
A real man never makes multiple-choice questions!
I want them all!
“See you tomorrow night then!”
A fragrant breeze blew towards him, and Gwen’s tender lips quickly touched Hood’s face, then she ran away quickly with a red face.
Watching Gwen trotting back to the ward, Hood’s mouth corners couldn’t help but rise.
“Is this the breath of youth?”
He is now looking forward to dinner tomorrow night.
[Ding! You are kind-hearted and kind-hearted, and your love is boundless. Heal George Stacy! ][Get reward: Artificial Intelligence Red Queen! ][Artificial Intelligence·Red Queen]: An artificial intelligence from the Resident Evil universe. She is spread across every corner of the Earth’s network system, and you can call her directly.
“AI Red Queen?”
Hood was delighted. He didn’t expect that he would receive this reward.
Red Queen is a powerful artificial intelligence, at least more powerful than all the artificial intelligences on Earth at this stage in Marvel.
Take Ultron for example, he is far inferior to Red Queen in all aspects of intelligent calculations.
Because the Red Queen already has her own consciousness, coupled with a huge network, her powers are extremely terrifying.
“Red Queen!”
Hodder put on the headset he carried with him to make the call.
Now Red Queen is online and can be called at any time.
“Master, I’m here!”
Red Queen’s firm voice came from the headphones. It was the voice of a little girl.
“Help me retrieve a confidential file of S.H.I.E.L.D. and a file related to the Cosmic Cube.”
The reason for doing that was to test the strength of the Red Queen.
SHIELD’s security wall is the most powerful in the entire United States.
Once she is able to obtain these top-notch information, it means that Red Queen can penetrate every pore of the world’s network.
“Master, the invasion has been successful, and the information you want has been obtained!”
In just a moment, Red Queen’s voice rang out from the headphones.
Hood’s phone vibrated. It was clearly the file of S.H.I.E.L.D.’s Cosmic Cube, at level nine!
It is the second highest top-secret level of S.H.I.E.L.D.!
Because the top secret files, which are level 10, are in paper format and cannot be hacked into.
“It seems that you have pretty good abilities!”
Hod slid twice casually and nodded secretly.
Having artificial intelligence means that any device connected to the Internet will not be able to monitor itself!
Recently, my actions have become increasingly “conspicuous”.
It is estimated that it won’t be long before SHIELD and Hydra will notice me.
After leaving the hospital.
Boom boom boom~
As soon as Hodder returned to the Cayenne, he heard someone knocking on the window.
Turning around, the person outside the car window was Tony Stark wearing sunglasses.
“Hodder, it really is you!”
As the car window rolled down, Tony looked surprised: “Are you sick? Why didn’t you contact me? I have the best medical team!”
He had just noticed this Cayenne. After all, there was only one Cayenne of Hood’s in the whole of New York.
“No, I just came to visit a friend.”
Hodder shook his head and spread his hands, then asked with a smile, “Why is the chairman of Stark Corporation here?”
He really didn’t expect that Tony would show up at St. John’s Hospital.
St. John’s Hospital is considered top-notch, but it is nothing compared to Tony’s medical team.
Tony sighed and walked around to the passenger seat, opened the door and got in.
“I came to visit the injured civilians in Sokovia…”
He grinned at himself.
“Feel sorry.”
Hod looked at Tony’s bitter expression and knew that Tony was feeling very uncomfortable.
But he didn’t expect that Tony would come to the hospital in person.
“No need to apologize.”
Tony smiled bitterly, shook his head and sighed: “If it wasn’t my fault, it wouldn’t have turned out like this.”
His decisions harmed too many people, which made him feel extremely guilty.
“and……”
Tony paused and then said, “If it weren’t for Wanda, I wouldn’t have the face to see the wounded.”
He knew very well that the reason their reputation was slightly restored was entirely due to Wanda.
“However, I see that Wanda’s approval rating has also skyrocketed. You should be free from the spotlight now.”
Hood also noticed this matter, and it must be said that this time he directly restored his previous image.
There has been a lot less negative news about the Avengers recently.
After Tony lowered the passenger seat a little, he sighed with concern, “But this matter doesn’t seem to be that simple.”
“What’s wrong? Any other questions?”
Hood could also see that Tony’s face was full of sorrow.
“Wanda is hiding something from us, and someone is helping her.”
“Of course I understand it’s a good thing, but she didn’t trust us and didn’t tell anyone.”
Tony spoke out his worst worries.
This person must be extraordinary to be able to make Wanda change.
What he was more worried about was whether this person had other intentions towards the Avengers.
During this period of time, he was basically trying to find out the identity of this mysterious man.
[Master, after checking, it was found that Tony Stark is investigating Wanda, and you may be involved! ]At this time, Red Queen’s voice came from the headphones.
Investigating?
Hodder was stunned, but soon understood.
Tony has always been a man of action, and he probably started investigating when he found out about this.
However, he did not expect that Wanda did not reveal the relationship between them.
Hood turned his head and looked at Tony who had a sad expression on his face. He wanted to tell him, but finally decided to forget it.
He needs to respect Wanda’s choice. Maybe she herself feels that the time is not right yet.
“Don’t worry too much, Tony.”
Hod patted Tony on the shoulder: “Maybe Wanda is waiting for the right time.”
“When is the right time?”
Tony was stunned for a moment, then turned to look at Hood with confusion.
“She trusts you and may need to adapt. Rushing will only make the situation worse.”
After hearing Hood’s explanation, Tony hesitated for a moment, and finally nodded slightly.
What Hood said made sense. If he pushed too hard, Wanda might be disgusted.
Because this is Wanda’s privacy no matter what.
“Hood, thank you. I’ll treat you to a meal some other day. I’ve been too busy lately.”
After Hood’s persuasion, Tony finally decided to listen to Hood.
When you get back, tell Little Pepper to stop investigating.
Hodder responded with a smile.
I didn’t expect that so many people would invite me to dinner recently.
Chapter 31 Lace-edged inner wear, you carry a gun when you go out? (Old version)
Central Avenue in New York City.
“It’s okay, I’ll contact you later.”
Hodder sat down, leaning against the door of the Cayenne and waved his cell phone.
This is the third beautiful woman who has come to ask to add his face
He couldn’t help but sigh that a good car is really attractive.
The phone in my hand vibrated.
[Wanda]: Hood, when will you be free?
When Hood saw the message, the corners of his mouth slightly raised. He really couldn’t wait.
[Hodder]: You are such a greedy little cat. Do you want to eat it so much?
[Wanda]: Stop talking nonsense! When are you free so I can reserve a seat.
On the other side, Wanda was in the room, looking at the crimson clothes in the closet and feeling worried.
The moment she saw the message, her cheeks felt slightly hot and she couldn’t help but squeeze her legs together.
Hodder hesitated and tapped his phone.
【Hodder】: About eight o’clock in the evening.
[Wanda]: Okay, see you at St. Is’s Restaurant tonight!
[Hodder]: Okay.
Wanda replied to the message with a smile on her face and humming a song softly.
Looking at the dazzling array of clothes, my attention finally focused on a set of semi-transparent inner wear made of lace material.
“Mr. Hodder!”
Hodder, who had just replied to the message, was about to put his phone away when he was suddenly tapped on his right shoulder.
He turned around and looked. Wasn’t that the lovely Gwen?
When he noticed what Gwen was wearing, he couldn’t help but be stunned.
Gwen, who has fair skin, is wearing a well-tailored pure white shirt today.
The slightly open collar reveals her slender snow-white neck, her short hair is silky smooth, she looks heroic and beautiful, and her fair skin is further highlighted.
The thin shirt made her figure stand out even more, and the long line that symbolized her career made him unable to help but admire her charm.
Although her figure is not as explosive as Wanda’s, her youthful cuteness makes him feel a little excited.
“You’re here?”
Although Hood’s heart was in turmoil, he remained calm on the surface and casually put his phone in his pocket.
“What was Mr. Hodder busy with just now? He seemed very absorbed in it.”
In fact, Gwen noticed not far away that Hood seemed to be replying to some messages.
“Nothing, just arrange things for tonight.”
Huo De looked calm, and didn’t even blink when he mentioned this matter: “By the way, your outfit today looks pretty good!”
After all, as a good man who has been through many flowers without getting hurt, he is very familiar with changing the subject.
“Really?!”
Gwen was indeed attracted by this sentence, and she turned around on the spot with excitement.
She bent slightly to show off her figure.
In order to keep the appointment today, she spent more than an hour just choosing clothes.
Looking at Gwen’s beauty, Hood couldn’t help but secretly sigh that she was simply a walking clothes rack who could handle any style.
“What’s wrong with Mr. Stacey’s body?”
Hod coughed lightly and shifted his gaze.
Although good wine is delicious, please don’t drink too much.
“Thanks to Mr. Hodder, Dad is now back to normal and can go back to the police station again!”
Gwen mentioned this and an excited smile appeared on her face.
Yesterday, after making sure there was no problem, my father couldn’t wait to go back and try the gun.
Moreover, the police station also agreed to let my father return to work.
For the father, this was the happiest news.
“By the way, where are we going to eat?”
Since Gwen was treating today, Hood didn’t make a restaurant reservation.
“Can we walk around outside first?”
For some reason, Gwen did not answer Hod’s question, but asked with her hands behind her back, blinking her big eyes.
Huo De glanced at the time on his watch and nodded slightly: “I’ll do as you say.”
It’s only six o’clock in the evening. If we make the right arrangements, there’s still enough time.
“Follow me!”
Gwen smiled happily, took Hood’s hand and walked quickly forward.
Her cheeks felt slightly hot when she made this move, but she did not let go.
She pulled Hood along the way, through several streets and into a forest park.
It is autumn now, and there are a large number of maple trees planted in the forest park.
The light of the setting sun shines through the leaves, creating a Tyndall effect. The rays of light shine on the ground covered with maple leaves.
A forest of yellow leaves formed, the afterglow of sunset shone, and the two people stepped on the piled up fallen leaves, making a rustling sound.
The two sat on a wooden bench in the park and watched the sun slowly setting in the sky.
“The scenery here is really nice.”
Hodder looked up at the fallen leaves blown by the breeze and sighed.
I seldom come to Queens, and this is the first time I know there is such beautiful scenery here.
Beautiful scenery
Beauty is more pleasant.
In the setting sun, Gwen looked even more charming.
Gwen took a deep look at Hood beside her and said, “I like it here very much. I come here almost every day.”
Only by coming to the park could she temporarily escape the depressed emotions in her heart.
“I thought people in Queens had long since grown tired of the scenery here.”
Hodder turned his head, looked at Gwen and teased.
“During the time when my dad was in a coma, I would always come here alone and stare blankly when I was depressed.”
Gwen and Hord’s eyes met, and she opened her red lips slightly: “But now my mood is completely different from before. Everything is finally getting better!”
At that time, she had to work to supplement her family income, and she also had to fight crime and uphold justice in her heart.
Basically, I have no time of my own, and only when the sun sets can I take a few minutes to enjoy the sunset here.
Now that she is finally getting better, she even feels like she is dreaming.
“As long as you stay optimistic, a lot of things will be fine.”
Hodder smiled and rubbed Gwen’s head, with the corners of his mouth slightly raised.
In fact, he also knew that Gwen had endured enough.
To put it bluntly, Gwen is just a student now.
And at this moment, accompanied by a gust of fragrant wind, a soft and fragrant body suddenly fell into his arms.
The fresh citrus scent entered Hood’s lungs as he breathed in.
He looked at the warm and soft beauty in his arms and was stunned for a moment.
I really didn’t expect that Gwen would pounce on me at this time.
For a moment, the air was silent and neither of them spoke. Hodder hugged Gwen and felt this warm moment.
“Um, did you bring a gun with you when you went out?”
I don’t know how much time has passed, Gwen said in an embarrassed tone.
Hodder’s expression suddenly became a little embarrassed: “It’s okay, it’s normal to carry a gun when going out!”
“oh.”
Gwen didn’t leave. Instead, she hugged Hood tightly with her ears red.
“Let’s go eat!”
Hod glanced at the time and spoke awkwardly.
Gwen nodded slightly and took the initiative to shake Hord’s hand.
Huo De asked, “By the way, where is the restaurant you are looking for?”
“It’s nearby, we’ll be there soon.”
Gwen took Hodder’s hand and walked out of the park.
Feeling the warmth in her hands, she suddenly felt mixed emotions.
“By the way, Hod, you and Wanda are very familiar with each other, have you known each other for a long time?”
She had actually thought of this yesterday, otherwise Wanda would not have come out alone with Hood.
“Very familiar, but only known for a week.”
After saying this, Huo De couldn’t help but complain in his heart.
We have become so familiar with each other that she knows my strengths and weaknesses, and I know her ins and outs.
But I was telling the truth, after all, we had only known each other for a week.
However, due to the power of the Phoenix and chaos magic, the two are very familiar with each other.
“It turns out we’ve only known each other for a week.”
Gwen was delighted to hear this, this was much better than she thought.
After all, she herself didn’t know what the relationship between the two was.
Her intuition at the time was that the two seemed very close.
“Where is the restaurant you mentioned?”
Hodder stopped and looked around to ask.
“Hey, there it is.”
Gwen pointed to a lavish restaurant on the corner.
The sign reads “St. Is’s Restaurant”
“Saint Is?!”
Hodder twitched the corner of his mouth and raised his eyebrows slightly.
Wait, if I remember correctly, Wanda also booked this restaurant!
Chapter 32: Almighty Hod, the most affectionate man in New York! (Old version)
How could it be such a coincidence!
Huo De helplessly stroked his forehead and sighed slightly.
“What’s wrong? Don’t you like this restaurant?”
Gwen noticed Hodder’s movements and asked with a worried tone.
She had done her homework in advance. This is the most famous restaurant for couples in New York.
Moreover, the dishes here are quite expensive, and she felt painful for a long time when she decided to book a room here.
Logically speaking, it shouldn’t be too bad, right?
“nothing.”
Huo De forced a smile and shook his head: “I just thought of some bad things.”
“That’s good. I thought you didn’t like it here.”
Gwen patted her chest and breathed a sigh of relief.
I thought Hod didn’t like it.
“How could that be? As long as I can have dinner with you, I’d love to have dinner anywhere.”
Hod held Gwen’s hand tightly and looked at Gwen with tender eyes.
When Gwen met Hood’s gaze, her cheeks suddenly turned red and she couldn’t help but avoid his gaze.
Although she had expressed her thoughts clearly, she was still shocked when facing Hood’s gaze.
She still felt extremely shy, after all, she had never had anyone she liked before.
“Well, come in quickly…”
Gwen’s voice was as soft as a mosquito’s. She lowered her head and pulled Hood inside.
An eighteen-year-old girl is easy to cajole.
What’s more, she is as white as paper.
Huo De raised his head, and his helpless expression became firm.
Since we want to pursue excitement, we must carry it through to the end!
The table was booked by the window facing the street, where one could overlook the scenery of the forest park outside.
The sky was slightly bright and red, and the setting sun was gradually setting.
Looking at the lake in the park, the rippling surface of the lake under the setting sun looks crystal clear.
Passing passengers embrace the evening breeze and enjoy the brief comfort after get off work.
Inside the restaurant, the band was performing BALLADE FOURADELINE elegantly.
Elegant music echoed in the restaurant.
“How is it here? Isn’t the environment nice?”
“I specially booked a seat here, the scenery is beautiful.”
After Gwen took her seat, she blinked her big eyes and looked around curiously, then asked in an excited tone.
She had indeed been in and out of many large and elegant occasions…
But those were the times when she was eliminating evil or saving people.
This is the first time I sit in a restaurant like this properly.
“Dear ma’am and sir, here is the menu.”
The waiter in a tuxedo stood aside gracefully holding the menu.
“Ladies first.”
Hodder nodded slightly with a smile on his face.
Gwen took the menu and looked deeply at Hodder, who was looking at his phone.
The more she got to know Hood, the more surprises he brought to her.
He is obviously an excellent person in all aspects, but he is still so humble and gentlemanly.
Facing Gwen’s gaze, Hodder just smiled.
He couldn’t care about these things at all now, his attention was all on his mobile phone.
[Wanda]: I’ll go to St. Is and wait for you. Remember to come early. I’ve booked a window seat.
Although Hood’s face looked calm, his fingers kept tapping on the table.
He really didn’t expect Wanda to come early.
He couldn’t even imagine what sparks would fly if Gwen and Wanda met.
And he noticed as soon as he came in that this was a couple’s restaurant.
It’s difficult even to explain.
What’s even worse is that this also booked a window seat.
If she knew that I had agreed to go on a date with other girls at the same time as you did, she would definitely be furious!
Thinking of this, he felt a headache. Do girls nowadays like to eat in the same place?
“Would you like to try the vegetarian soup and apple and carrot stew from this restaurant? According to the reviews online, they taste better than those in Italy.”
Gwen opened the menu and handed it to Hood, and asked with a hopeful look.
This is a European-style restaurant that serves a variety of European dishes, mainly Italian and German.
She had wanted to eat here before, but had never been willing to do so, so she also wanted to try this dish.
“I think it should be good. I like everything you like.”
Hodder’s mind was racing as he spoke to Gwen.
“It’s so kind of you!”
Gwen felt warm at heart as she looked at Hodder who smiled and nodded.
This is all based on my own thoughts.
The more this happened, the more moved she was.
However, she didn’t notice that Hood’s eyes were not on the recipe at all.
Now Hood has been thinking about how to avoid the two people meeting as much as possible.
After ordering, a blond waiter quickly brought the dishes.
“Please enjoy your meal!”
After saying this, the waiter did not forget to light the candle in the middle before taking two steps back and leaving.
“Try it now.”
Gwen’s eyes lit up as she looked at the delicious food served.
Her favorite thing is to try all kinds of delicious food.
“good.”
Hodder smiled and nodded, temporarily putting Wanda’s matter behind him.
There is still some time before Wanda arrives, so we can only deal with it as it comes!
Hodder took a sip of the milky vegetable soup in front of him.
The aroma is rich and complex, combining the freshness of fresh vegetables, the spiciness of spices and the richness of cream.
When you take the first sip, the smooth texture and rich layers of the soup unfold on the tip of your tongue.
In the chilly autumn weather, drinking this will warm your whole body.
“How about it?”
Gwen clenched her hands and waited for Hodder’s comment.
“Well, very good, the chef must be from Italy!”
Hodder nodded slowly and gave his evaluation.
“That’s good, it seems this restaurant is really good!”
Gwen breathed a sigh of relief. She had always thought that a wealthy man like Hood must have very picky tastes.
But it seems that he is not the kind of spoiled person.
“but……”
At this moment, Hood changed the subject.
“But what?”
Gwen’s heart, which had been relieved, suddenly lifted up at this moment.
“But it’s much worse than what I did.”
Hodder was not joking when he said this, he had a systematic reward.
His cooking skills are also top-notch. He can even tell how much seasoning the other person has used just by tasting the food with his tongue.
“Can you cook?!”
Gwen really didn’t expect that Hood could cook.
Even though he is so versatile, he hasn’t neglected his life skills.
“It’s natural. I have a very precise grasp of the seasoning. For example, this dish uses hand-ground black pepper and parsley…”
Hodder began to explain seriously how to cook the dish.
In fact, it is…
【Ding! You taste the best vegetable soup! 】
[Get reward: Master-level cooking skills! ]It’s good to have a system!
But Gwen listened very carefully and looked at Hood intently.
The flickering candlelight illuminated Hood’s handsome face.
Gwen’s eyes widened as Hood explained seriously.
She didn’t even notice what Hord was saying, she just nodded subconsciously.
To her, serious boys are so handsome.
Especially since he knows everything, but never shows any arrogance.
“If I could really be with him, I would definitely be very happy, right?”
An image of the two of them together suddenly popped up in Gwen’s mind.
Thinking of this, her cheeks couldn’t help but feel slightly hot.
This was the first time she felt inferior.
Although she is very powerful, there is a huge difference compared to Hood.
“Why is your face so red?”
Hood noticed Gwen in a daze and subconsciously touched Gwen’s face.
The moment they touched each other, Gwen suddenly came to her senses.
She felt the warmth on her face, and her heartbeat instantly accelerated. She could even hear her own heartbeat.
“Is there…is there?”
Gwen quickly shook her head, her eyes panicking: “Maybe the vegetable soup is too hot!”
“I thought you were drinking behind my back.”
Hodder did not expose Gwen’s lie, and said with a smile: “It’s a pity that I have to drive later and can’t order any wine.”
“No……”
Gwen’s voice was as thin as a mosquito.
At this point she was at a loss.
“No, Gwen Stacy, how can you be so weak.”
“Look if you want!”
“Didn’t you take the initiative to hug him and even kiss him!?”
“Even if I did…it doesn’t matter!”
Gwen tried to cheer herself up frantically, but the more she thought about it, the more confused her mind became.
At the door of the store, a familiar voice came from the direction: “Hodder.”
This familiar, cold, yet charming voice…
Hodder looked up suddenly and saw a woman in a scarlet windbreaker standing at the front desk.
Even with a mask on, he could still recognize that it was Wanda!
That windbreaker and that figure are so recognizable!
[PS: I beg for flowers, evaluation tickets, and monthly tickets to support me! ! ! ! ]Chapter 33: The affectionate character is about to collapse? Otherwise, let’s go together as a group! (Old version)
“The name I reserved is Hod Fernandez.”
At the front desk, Wanda took out her cell phone and showed the screen to the waiter.
But she didn’t notice that someone’s eyes were fixed on her.
“Why is she here?”
Hod would be a little embarrassed if Wanda looked over here.
She will definitely see herself and Gwen. I can’t imagine what that scene will be like. Wanda will definitely be furious.
After all, it’s not just about dating two people at the same time, but also in the same restaurant!
“No, no, think of a solution quickly!”
“Just go. It’s not polite to Wanda.”
“Tiger charm? No, this thing will split your personality into two!”
He really didn’t expect it to be so fast. It only took more than ten minutes for him to come over.
There is still more than half an hour before the meal starts!
Just then, the waiter took Wanda towards the stairs.
It looked like they should have booked a private room, and Hood finally felt relieved.
This is also consistent with Wanda’s personality, and as a celebrity, it should be impossible for Wanda to eat in public.
“Hodder, did someone call you?”
Gwen noticed that Hodder’s eyes were always looking behind her.
She turned her head and was about to look behind her.
At this moment, Hood’s scalp suddenly went numb. If Gwen saw Wanda now, there was a great possibility that she would say hello!
He knew that Gwen’s idol was Wanda, and he was really furious when he saw her.
At this critical moment, Hod held Gwen’s face in his hands.
The two looked at each other.
This sudden action made Gwen stop what she was doing, and her heart almost stopped beating as she looked at the approaching face.
This this this…
She never expected that Hood would suddenly come over.
Although this is a restaurant for couples, she has never been in a relationship before.
Her cheeks suddenly turned red.
Is this a sudden kiss? Should I respond or be reserved? !
Because the movement was so big, even the table made a creaking sound.
At the same time, Wanda, who was about to go up the stairs, heard the sound coming from not far away.
She looked over there with a puzzled look.
“Close your eyes!”
Hodder was not at all flustered and stroked the girl’s eyes with one hand.
Gwen was stunned, her heartbeat quickened, is this… is he going to kiss me? !
She slowly closed her eyes and even raised her jaw slightly.
It looks like it’s ready for you to pick.
At this moment, a green light emanated from the palm of Hood’s right hand.
The shape of a snake flashed across his palm, and he was instantly invisible on the spot.
At this moment, Wanda turned around and saw a beautiful girl with her eyes closed.
She didn’t care too much, shook her head and walked upstairs.
When Wanda turned around.
Hood instantly lost his invisibility and breathed a sigh of relief.
He gently touched Gwen’s eyelids before returning to his seat.
Gwen was slow to feel Hodder kiss her.
I only felt the touch on my eyelids and opened my eyes in confusion.
“There was hair on your eyelid. I took it off for you.”
Hood pretended to speak calmly, and did not forget to throw the missing hair on the ground.
“oh……”
Gwen heard this, but she didn’t know why she felt a little disappointed.
“You, aren’t you thinking about something wrong?”
Hodder grinned and started to tease.
“No way! You’re the only one who would think that!”
Gwen’s face turned red immediately. Hood actually said what he was thinking.
Huo De shook his head: “I was thinking about what dishes I should prepare to entertain you when you come to my house.”
This instantly drew Gwen’s attention to it: “I like German dishes, but I want to try your cooking myself.”
“How about I treat you to some German sausage?”
Hodder gave a wicked smile: “That’s the characteristic of Bratwirster.”
“Big sausage?”
Gwen pouted and thought hard: “Do you have this dish? I can try it!”
Shifting her gaze to Hood’s face, she always felt that there was something wrong with the expression on Hood’s face, and it always felt bad.
She didn’t care too much about it. If it was Hood’s, it should be delicious!
The two chatted happily for another ten minutes.
“Oh, I remembered I have a meeting tonight.”
Hodder glanced at his watch and looked at Gwen with a slightly apologetic look: “I’m afraid this is all we can do tonight.”
“Well, I have to go to class tomorrow too.”
Gwen could only nod. Even though she wanted to continue to be together, she knew very well how important a career was to a man.
Hod took Gwen’s hand and walked outside naturally.
When leaving the restaurant, he walked under the eaves for a while to avoid the sight of people upstairs.
After arriving at the parking lot, Hood drove Gwen to the downstairs of her home.
“I’m going back.”
Gwen stood in front of Hood and spoke reluctantly.
“Well, go back and have a good chat with your father. He should miss you a lot.”
Hood nodded quickly. It was almost late and he had to go back quickly.
“If you… have time, remember to find me.”
The next second, Gwen hugged Hood’s waist and put her head on Hood’s chest.
After a while, she ran upstairs with a red face.
“It’s finally over.”
Huo De let out a sigh of relief as he felt the remaining warmth in his arms.
[Ding! Your relationship with Gwen is rapidly heating up! ][Get reward: Black Shadow Corps – Ninja Corps! ][Shadow Corps – Ninja Corps]: You can summon the Ninja Corps from the Shadow Corps. They obey the summoner completely!
“It’s actually the Black Shadow Corps?!”
Hood was extremely surprised. He never expected to receive such a reward.
It looks like little Gwen is going to become his lucky star.
Ding Dong!
At this moment, Hod’s phone vibrated slightly.
【Wanda】: Are you almost there?
“Damn, I’m going to be late!”
Looking at the time, the corners of Hood’s mouth twitched slightly.
[Hodder]: There’s a little traffic on the road, we’ll be there soon!
Hodder hurried back to the car and headed quickly towards the restaurant.
“Eight ten.”
After getting off the car, Hodder looked at the time and shook his head helplessly.
It seems that my time management skills are not up to par, otherwise I should be able to connect with it.
After tidying up his clothes, Hood walked into the restaurant.
The waiter standing inside was stunned when he saw Hood come in.
The guest just left not long ago, why is he back again?
Hodder ignored the waiter and went straight up to the second floor.
The moment I opened the door, I saw Wanda sitting by the window in a crimson dress.
“Is there a lot of traffic on the road?”
“If I had known I would have asked you out this afternoon. You must be tired from driving for such a long time.”
Wanda saw Hood and pulled out the stool next to her, with a look of heartache in her eyes.
“For the sake of having dinner with you, a little traffic jam is nothing.”
Hood shook his head slightly and sat down next to Wanda without blushing or beating his heart.
“Isn’t the scenery here beautiful?”
Wanda, who was beside him, waited until Hood sat down and suddenly shook his hand.
The moment she held Hood’s hand, the corners of her mouth couldn’t help but rise.
At this moment, she felt how nice it was to have a loved one.
“Well, the scenery is beautiful.”
Hodder nodded, but unfortunately he had already seen it once.
“Every time I pass by here, I hope someone can accompany me to appreciate it.”
Wanda said as she leaned her head on Hord’s shoulder, but the next moment her eyes widened: “Why do you smell like a girl’s perfume?”
She clearly smelled perfume on Hood, and it was not a male perfume.
not good!
Hood’s heart skipped a beat. He had just been hugging Gwen, and the smell of perfume was all over his body.
He himself didn’t expect that Wanda would approach him so proactively tonight.
“I was in such a hurry just now that I bumped into a girl by accident. It must be the smell from her body.”
Huo De forced himself to calm down and spoke casually.
Wanda did not doubt it, but said: “Then don’t be so anxious next time, I can wait for you.”
Boom boom boom!!!
The blonde waitress pushed open the door of the private room and said, “You two, your food is ready.”
But when she looked up and saw Hood, she was stunned.
Isn’t this the customer who came in so hastily just now? !
When he saw Hood and Wanda leaning against each other, his eyes widened instantly.
Hodder suddenly felt that something was wrong.
Is it never going to end? I really want to see the Scarlet Witch appear, right?
“Okay, hurry up and serve the other dishes.”
He quickly waved his hands and urged, “Don’t let it slip out!”
But before the young lady left, she left a meaningful look.
“Hodder, what’s wrong with you today? You seem a little weird.”
Wanda keenly sensed that something was wrong with Hood.
Especially since she possesses chaos magic, she is more sensitive to mental fluctuations.
………….
Chapter 34: The drunken witch is more charming, crazy night! (Old version)
“I just don’t think I should be late for work.”
Hod held Wanda’s hand tightly and looked into her eyes affectionately.
“It’s okay. It’s normal to have problems… I’m glad you can come.”
Wanda looked into Hood’s eyes, and the doubts in her heart disappeared without a trace at this moment.
After all, Hood is so mysterious, it’s normal for him to have things to do.
“Cheers, stop thinking about it, and I hope you can get rid of those damn public opinions!”
Hodder raised the glass in his hand.
Wanda picked up the wine glass with a smile. She hadn’t been so happy in a long time.
After a few drinks.
“Well… Actually, besides treating you to dinner tonight, I have one more thing to do.”
Wanda’s cheeks were rosy, her eyes were hazy and glowed with a faint scarlet light, and she stared at Hood with charm.
She really had so much to say in her heart.
“What’s up?”
Hood put down his wine glass with a puzzled expression and turned to look at Wanda.
The moment our eyes met, my heartbeat suddenly quickened as I looked at that extremely charming face.
Wanda drank some wine, and her fair face looked like her code name, Scarlet, covered with a layer of pink, which made her look indescribably charming.
For a while.
The air in the box was filled with the scent of hormones, and the two people’s eyes were entangled and twisted.
No one looked away first, and everything around seemed to have quieted down.
“You…what do you want to say?”
Hodder’s Adam’s apple rolled and he repeated it again.
He looked into the witch’s melancholy eyes. Under the faint orange light, her face seemed to be covered with a veil, making people unable to help but further uncover it.
I don’t know if it’s because Wanda’s body temperature has risen, but the smell of her perfume has become stronger at this time.
The scent of tuberose mixed with the aroma of wine hits me in the face.
“I…I…”
Wanda opened her red lips and tried to say it several times, but she couldn’t.
She wanted to express her emotions, but at this moment she felt fear.
Because although they said that everything that should have happened had happened, the progress was really too fast.
“Ahem…it’s actually not a big deal.”
Wanda finally backed off. She was still afraid of feeling love for the first time.
When it comes to love, I am just a little girl after all, and I don’t even know how to start.
And the closer she got, the faster her heart beat.
“You can tell me anything you want.”
Hod held Wanda’s hand and said firmly, “No matter what happens, I will stand firmly by your side.”
He could see that Wanda did have something to say, but she probably didn’t say it because of her low self-esteem.
“No……”
Facing the gentle and considerate Hod, Wanda shook her head: “Really not.”
Only she knows what she is worried about.
She didn’t know what the relationship between them was.
Although those things happened, the relationship has never been confirmed.
She didn’t know whether Huo De would leave her after she expressed her love.
Just thinking about this made her feel terrified.
The person she trusts most now is Hood. If Hood abandons her.
She couldn’t even imagine how much pain she would be in, but if she didn’t speak, she could keep going.
Even if…even if this shameful relationship will always remain.
It is also for this reason that she has never told the Avengers about Hood’s identity.
Because she didn’t know how to tell others about Hood’s identity.
“How about we go back and talk?”
Hodder looked at Wanda, who was drooling over her desire, and he was almost unable to hold back his urge.
I’ve been teased so many times today, and we’re both alone.
A woman with fair skin, a perfect figure, and a rosy face, not saying anything, but taking deep breaths…
With every deep breath, Hood could feel the hot breath hitting his skin.
He couldn’t help but take a look at the ravine that looked like an abyss.
Wanda probably doesn’t know how good her figure is, she even wears a red dress.
Looking at the edge with a hint of crimson lace, he felt his blood boiling.
Any man with normal function would find it difficult to resist temptation at this moment.
“Don’t leave!”
Wanda pouted and shook her head.
Wine has a strong aftertaste, and the alcohol has already started to take effect at this time.
She didn’t want Hood to go back like this, she wanted to stay with Hood.
Wanda was obviously really drunk.
Every word and action carries the unique flavor of alcohol.
“But……”
Hodder took a deep breath, but the aroma that poured into his lungs made him even more intoxicated.
“Can’t you have a few drinks with me?”
Wanda hugged Hood’s right hand, and suddenly she felt a softness.
She leaned against Hood and kept acting coquettishly, her voice becoming extremely charming at this time.
Hood suddenly discovered that Wanda was like two completely different people after drinking.
The last time I got drunk, it was pretty much the same thing.
A melancholy but well-behaved one.
A melancholy but crazy billion point.
As she was about to sway, the straps of her red dress slid down her shoulders.
The shoulders, as white as snow, have an extremely perfect shape.
Because the movement was so large, Hood could even see the snow-capped mountain held up by the lava.
This perfect combination of snow-capped mountains and lava is like the most beautiful scenery in the world.
With the movement of the lava, even the snow-capped mountains were shaking constantly at this time.
I have to say that Wanda’s figure is relatively thin, but she has an indescribable plumpness.
Just looking at this made Hood’s breathing become heavier.
He could even feel that the Kunbang had undergone tremendous changes.
“Dizzy.”
Wanda poked Hod’s cheek lightly with her fingertips, then fell directly onto the table.
Wanda, now drunk, unbuttoned her windbreaker, revealing her milky white skin under the thin lining.
She lay on the table, with a playful
“Wanda, sit down.”
Hodder took in the alluring sight and pulled her back, panting.
“No, I like to drink lying down.”
Wanda waved her hand, took the bottle, and poured it into her mouth without hesitation.
Phew!
Because he was lying prone, the liquid came out the moment he drank it.
The scarlet wine slid down the neck, and even wet the lining.
“Depend on……”
Hodder really couldn’t help it.
This was simply challenging his resistance.
He is not Liuxia Hui!
Legend has it that the more powerful the witch is, the more beautiful she is. She is full of charm and attracts you everywhere.
Wanda Maximoff is the legendary witch.
Sometimes, even unintentional actions can lead to crime!
“Let’s go back!”
Hood directly put Wanda’s hand on his shoulder, ready to help Wanda back.
“No!”
Wanda shook her head. She didn’t want to go back into the room.
And she enjoyed being next to Hod.
Only when she was with Hood could she do whatever she wanted.
“Then what do you want to do to go back?”
Hod looked at Wanda, who was extremely drunk, and shook his head helplessly.
Wanda forced herself to stand up straight with her weak legs and put her hands on Hood’s shoulders: “You said you like…”
But before she could finish her words, she lost her balance and Wanda fell directly on Hood’s chest.
(·x·)
Coming right at you.
Carrying the ball into someone!
foul!
I can’t stand it anymore!
Hod raised his right hand suddenly in the air.
The Phoenix Force was used so smoothly for the first time.
The door of the box was locked with a click.
“Today I must show you the power of the Bull Talisman, the Monkey Talisman and the Rabbit Talisman!”
Chapter 35 You can use your mouth, I will never drink milk again! (Old version)
The next day, on the white and comfortable big bed, the white body stretched out freely.
The sun is shining outside and the room is full of spring.
“uh-huh……”
Wanda’s eyelashes trembled slightly and she slowly opened her eyes.
Her whole body felt like it was falling apart, with a feeling of soreness, pain, and comfort spreading throughout her body.
“I am…”
Wanda raised her head and looked around the room: “Inside Hod’s room?”
She could tell at a glance that this was in Hodder’s room.
When I saw the mess scattered all over the ground.
She couldn’t help rubbing her temple.
Although I had prepared myself mentally yesterday, I didn’t expect to actually come to Hood.
“I remember that after I drank yesterday, I…”
When she remembered what happened yesterday, her face turned red instantly.
Although I thought something exciting would happen, this is too exciting!
Just thinking about it.
She wanted to cover her face with something.
“It’s so embarrassing!”
“I was drunk, and that guy Hood didn’t stop me!”
When she thought of this, she couldn’t help but want to kick Hood.
That place didn’t even stop me from clicking, and the scene was chosen randomly, right?
“But what about that guy?”
Wanda rubbed her sore waist and gritted her teeth.
This guy is so abominable that she even wants to pinch Hood hard.
But no matter how he looked, there was no sign of Hood in the room.
“Could it be that he went out for some urgent matter?”
Wanda shook her head. After all, in her eyes, it was normal for Hood to deal with a lot of things every day.
Thinking of this, she supported her extremely tired body and got up to take a shower.
I dare not imagine what kind of torture I went through last night to make me so tired.
After a busy night, my body is already sticky.
Wanda walked to the bathroom door with her body without a trace of fat and pulled the door.
Thick fog was coming towards us.
“Didn’t Hood even turn off the sauna before he went out?”
Wanda couldn’t help but mutter as she looked at the empty bathroom.
Nowadays, many people’s bathrooms have been equipped with sweat steaming equipment, so Wanda was not very surprised.
“never mind.”
Wanda shook her head, and just as she walked in and was about to close the door, a figure approached from behind the door.
She immediately recognized the man as Hood.
“I didn’t expect that the little witch actually had a hobby of peeking at other people washing their clothes.”
“There will be a price to pay for just barging into the bathroom!”
Hood’s voice is deep and very magnetic just by listening to it.
“I…I didn’t.”
Wanda’s heartbeat suddenly accelerated, and she felt a burning sensation on her back.
“How did you get in? Have you not had breakfast yet? I’ll give you breakfast!”
Hod grinned wickedly and moved closer, even being able to feel the other’s breath.
Wanda met Hood’s eyes and her expression suddenly became extremely panicked.
She didn’t even know where to look, so she just gritted her teeth and met Hood’s burning gaze.
“What breakfast? I don’t want to eat breakfast.”
Wanda’s face flushed and she shook her head repeatedly. She tried to push away but was pushed against the wall.
Hord raised a playful smile at the corner of his mouth: “If you are hungry, tell me. It is really rude to rush in directly…”
“Who… is hungry… don’t talk nonsense…”
Wanda’s earlobes were dyed red, and she looked like a completely different person compared to when she was drunk.
But the more this happened, the happier Hood was.
After all, even if you are playing LOL, you need to change the map occasionally!
Since the map had been changed, he was naturally very happy.
“If you’re not hungry, why did you just push the door open? Can’t you knock?”
Huo De looked at the snow mountain relentlessly, with malicious intent in his eyes.
Since the meat is delivered to the door, as a wolf, he will naturally not let it go.
In particular, he could also smell the aroma of meat coming from the flesh.
Surrounded by white mist.
That beautiful face that can be both domineering and sweet, shyly blushing and tender, is charming and attractive.
A pair of wet eyes, deep and moist.
She had just woken up and looked clear and pure, yet charming.
The corners of her eyes were still red and seductive. Perhaps she was nervous at this moment, and the corners of her charming lips were trembling.
“Um… I’m going out first…”
Wanda hurriedly tried to push Hood away. After all, she was very tired.
I simply didn’t have the energy to continue. After all, fighting required a lot of energy.
Although Hood is the main fighting force, the interaction between forces is relative.
“You don’t want to wash up?”
Hod grabbed Wanda’s wrist.
As a gentleman, you must urge others to keep themselves clean.
“Do you want me to die?”
Wanda panicked.
What a joke!
Yesterday was crazy.
Still coming?!
She couldn’t help biting her lips.
Um……
I have to say, Hood’s figure is no joke.
The abdominal muscles are well-defined and very strong.
“No, there are actually many places where it can be used.”
Hodder raised his lips in a smirk.
“What’s the meaning?”
Wanda was stunned when she heard this, her head didn’t wrap around it.
Just as the witch was stunned.
Huo De reached out his big hand and touched the corner of her lips.
Woo woo woo……..
Wanda: (ΩOΩ)!!!
After a long time, inside the restaurant.
At the dining table, Hod looked across at Wanda.
Wanda touched her rosy lips, tears welled up in the corners of her clear eyes, her pink and rosy face was charming and seductive.
It’s so shameful!
“Come on, you must be hungry!”
Hodder handed over a cup of freshly heated milk with a wicked smile.
yue~
Wanda felt terrible and almost had a dry mouth. There was no taste at all.
“If you don’t want it, forget it. There is a country that emphasizes like cures like. I have to make up for it!”
Hod drank the pure milk in the cup.
Wanda looked at Hood’s expression and knew that he must have done it on purpose.
She no longer dared to look directly at pure milk.
“Okay, no more jokes, I’ll be more careful next time.”
Hod stood up, rubbed Wanda’s little head, and spoke with a smile.
“There won’t be a next time. You can do it yourself next time…”
Wanda’s wrath
This guy is still thinking about next time!
Such a dirty thing
If she does it once, she will regret it for the rest of her life!
At this time, the servant came over and said, “Sir, there are two middle-aged men in costumes outside who want to see you.”
Hod asked with a puzzled look on his face.
In costume?
It seems that he has not invested in any movies.
Maybe?
He didn’t remember. After all, he had so many businesses under his control and it was impossible for him to manage them every day.
“He calls himself Doctor Strange.”
The servant said with a puzzled tone.
“It turns out to be a magician. Let him in.”
Hood was surprised how this guy came here.
What does Doctor Strange want me to do?
Accepting disciples?
I don’t want to go to Kamar-Taj to be a wizard. I want him to practice all day long, not go out, and not get involved in worldly affairs.
It would be better to die!
[The data is increasing very slowly. I hope you guys can support me by giving me some data. I will update the book appropriately before it goes on sale. Once it goes on sale, I will directly update 50,000 words, with a minimum of 20,000 words a day! ! ! ]Chapter 36 Doctor Strange comes to visit. This guy actually hooked up with Scarlet Witch?! (Old version)
“So it’s Stephen. Just now Imelda told me there was a magician, and I was wondering who it was.”
In the waiting room, Hood lit a cigarette and looked at Stephen, who was sitting opposite him, with a look of surprise.
He really didn’t expect that Stephen would come here to find him.
“Have you ever seen a magician in any circus as gentlemanly and handsome as me?”
Stephen leaned back in his chair and spoke with a hint of displeasure.
This guy really manages to make him unhappy every time he opens his mouth.
“No, but your clothes are not very common.”
Hod looked at the floating cloak behind him and teased.
“This is my exclusive suit, how can it be seen so often?”
Stephen took a deep breath, and the sound seemed to be squeezed out from between his teeth.
He really didn’t expect this guy to speak so irritatingly.
I even suspected that this guy was deliberately doing something cunning to me.
If he hadn’t wanted to maintain his gentlemanly demeanor, he would probably have taken action.
“Stephen, be quiet!”
Wang on the side interrupted Stephen with a serious look: “We have serious business this time!”
Stephen shut his mouth awkwardly. They did have something important to do this time.
“No one comes to visit you for no reason. Tell me, what is it?”
Hood also knew very well that if nothing happened, these two people would never come here.
“Have you ever heard of nightmares?”
Stephen took a deep breath, and his expression immediately became serious.
“nightmare?”
Hod frowned slightly and said, “You mean, a demon that relies on absorbing the power of dreams?”
The Nightmare is a demon of unknown origin that can pull sleeping creatures into nightmares and torture them.
Once entering a nightmare, the nightmare is almost omnipotent. In addition, this demon is also proficient in magic.
So once the other party is awake, they will send their men to attack them.
If an ordinary person faces a nightmare, he will lose his will in just a moment.
It is said that only gods and extremely powerful magicians can resist this kind of attack.
The most terrifying thing is that Nightmare can absorb the fear of others and become stronger.
“I didn’t expect you knew anything. I thought you had no interest in magic or anything like that!”
At this time, Stephen did not forget to interrupt and tease Hood.
“Wang, can you bring a quieter guy next time? This guy talks too much!”
Hodder ignored Stephen, but spread his hands and spoke to Wang with a helpless look on his face.
Stephen felt unwell when he heard this. He took a deep breath before saying, “We hope you can help us.”
He realized that if he continued to argue with Hood, he would never be Hood’s opponent.
This guy seems to be proficient in all disgusting words, and he doesn’t even repeat himself.
“What help? What does it have to do with this nightmare?”
In fact, Hood was also very curious about what was going on. Why did two great wizards need his help?
No matter how you look at it, this matter is definitely not simple.
“What are you talking about?”
“What nightmares, and some magic or something?”
Wanda was seen walking down the stairs slowly and gracefully.
She had been eavesdropping at the stairs just now, and now she couldn’t help but show up and ask.
If it was about magic, she would also like to know about it.
And she recalled that Hood also said that he could do magic.
“Have you finished your breakfast? Come over and chat with me. This magician is quite interesting.”
Hood greeted Wanda and teased Stephen in his words.
Wanda slowly sat down on the sofa, and Hood casually put his arm around Wanda’s slender waist.
the Avengers?!
Stephen recognized Wanda’s identity the moment she appeared.
He really didn’t expect that Wanda would appear here, and seemed to have a very close relationship with this kid.
“Boy, I really misjudged you. Now I have a new respect for you.”
This kid actually managed to date one of the strongest Avengers, that’s really amazing.
“Okay, tell me what you want from me!”
Hood waved his hand unhappily and brought the conversation back to the point.
After all, he was really curious about what the person was looking for him about.
And he is also quite interested in this nightmare. To be honest, this thing is quite interesting.
“I have a spell here that I need your help to break, otherwise we won’t be able to find Nightmare’s apostle in the mortal world!”
Stephen straightened his body and held his right hand outstretched as he spoke.
A bag at the side floated up out of thin air, and a roll of parchment slowly floated onto the table and slowly unfolded.
From the appearance, this parchment scroll has a long history, and there are many complex and strange runes on the yellowed leather surface.
“Looking for the Apostle of Nightmare?”
Hood also knew that there was no way that Nightmare could descend directly upon the mortal world, that is, the Earth.
Therefore, apostles among men are needed to act as intermediaries.
Therefore, as long as the apostles are dealt with, the nightmare will not be able to directly contact the mortal world.
“We have been worrying about this spell for two days and two nights.”
Wang Zhuangshuo moved his body on the sofa, looked at the parchment scroll and said.
No matter what method they used, they couldn’t crack it.
That’s why he suddenly remembered Hood who performed a miracle that day.
“I only found out about this spell this morning, but the king insisted on coming to you, otherwise I should be able to do it myself.”
Stephen couldn’t help but retort at this time.
In fact, when he saw the spell, he already knew how difficult it was.
If he were to crack it, it would take at least several weeks because there are so many things involved.
Even though it is just a short spell, it contains so much information.
“If you are not good at it, practice more. If you can’t afford it, don’t play it.”
Hodder glanced at Stephen with disdain.
Hood was seen holding a cigarette in his mouth, making hand gestures, and looking at the spell on the table with a serious expression.
With his top talent, he understood the logic of the spell at a glance.
And the next second.
A huge magic circle flashed around, and a dark black mark spread rapidly on the ground.
An eerie and terrifying force emanated from the magic circle, and a strange black gas floated towards the sky.
In just a moment, a black star pattern formed on the ceiling.
There is also a bright star on the star map, which clearly points out the direction.
“It’s unlocked.”
Hood picked up the cigarette and flicked the ash slightly, as if he was doing something insignificant.
Stephen and Wang looked at each other, their eyes filled with disbelief.
Originally they thought it would take a long time, but it only took one glance!
Just one glance revealed it?! What kind of top-notch pervert is this!
The two of them were stunned for a long time and neither of them spoke.
“Hurry up and leave!”
Hod waved his hands unhappily: “Don’t waste my time enjoying life!”
The two stood outside the gate, disheveled in the wind.
Chapter 37: A Test from Ancient One! Is This Guy a Foot Fetishist? (Old Version)
Fine snowflakes floated in the air and slowly fell on a brown roof.
Looking around, the temple was covered with snow, but there was not a single snowflake on the floor in the courtyard.
This is the holy place where white magicians practice – Kamar-Taj!
In the reception room of the dojo, the aroma of tea spread throughout the room along with the cold air.
The tea in the cup exudes a thick mist.
Gu Yi sat cross-legged in front of a tea table and slowly placed the teacup in front of Stephen and Wang opposite him.
“Have you already tested him with the spell?”
Gu Yi focused his eyes on the purple clay teapot in front of him and slowly scraped away the tea residue on the tea.
He didn’t seem to care about the matter very much while speaking, and his eyes were full of calmness.
“Well, although I can’t believe it, he did it!”
In front of Ancient One, Stephen was not as unruly as before, but had a serious expression.
Wang waited for the tea to be poured into the cup while he was sitting cross-legged. He drank it all in one gulp before he spoke: “He solved it perfectly!”
I have to say, he was shocked for a long time when he saw it today.
Even when they were led out the door, it took them a long time to come back to their senses.
This was simply the most talented wizard he had ever seen in the world.
Gu Yi nodded slightly and poured most of the tea into Wang’s cup before withdrawing his hand.
She raised her hand slightly and waved it lightly, and the spring water in the old bucket beside her poured into the kettle like a silver thread.
Then he placed the kettle on the stove where the flame was dimming.
With a flick of his finger, the dimmed flame instantly burst into flames.
The sparks slowly floated into the air following the heat and disappeared.
“Master, I don’t understand why you want to test him with this spell.”
Stephen couldn’t hold back after all and asked.
After all, Ancient One rarely does meaningless things. Logically speaking, she must have her reasons for doing so.
But he couldn’t figure out why he did that.
“This spell is rarely known to outsiders, and it is extremely difficult.”
“Ordinary mages need to learn the basics for more than ten or twenty years before they can comprehend it, and Hord is only twenty-four this year.”
When he said this, a barely perceptible surprise flashed across Gu Yi’s eyes.
She had to admit that even she took a long time to cast the spell.
But according to the two people’s description, they understood the steps of the spell just by taking a few glances.
In every sense, this was the most terrifying genius she had ever seen.
Although Gu Yi had no expression on his face, Stephen was still very keen to notice the change in Gu Yi’s expression.
“You mean, he’s really gifted?”
Although Stephen didn’t want to admit it, this was the fact before him.
What he couldn’t do, Hood did so easily.
This was an indescribable blow to him.
Gu Yi poured the boiling hot water into the newly replaced tea leaves, and the mist rose like a dragon.
Although it was just one word, her tone was full of determination.
“Should we recruit him into Kamar-Taj then?”
The king, who had been mostly silent, suddenly spoke.
They need such power, and this person’s future must be limitless.
If they can recruit him, it will definitely be a good thing for Kamar-Taj.
“Not for now.”
Gu Yi shook his head slightly, looked at the tea leaves bubbling in the hot water and said, “I have my own arrangements, you guys go back first!”
The two men stood up and saluted respectfully before standing up.
Wang waved his right hand violently, and the dimensional gate appeared in front of the two of them.
The Statue of Liberty appeared in the other end.
After the two of them stepped through it, the dimensional gate disappeared like a stream of light.
After the two left, the calm expression on Gu Yi’s face gradually became solemn.
She closed her eyes, adjusted her breathing, and drank the tea in the cup.
After doing all this, she sat cross-legged with her hands naturally placed on her legs.
As her eyes slowly closed and golden light shone around her, the Eye of Agamotto on her chest floated up.
The next second, a dazzling light burst out from the Eye of Agamotto.
“puff!”
But at this moment, Gu Yi suddenly spat out a mouthful of scarlet blood.
Even the antique coffee table in front of him was stained with blood.
She widened her eyes and murmured worriedly, “I can’t see the future of Huo De…”
Just now she tried to use the Time Stone to peek into the future.
But whether in the past or the future, Hood’s existence was not seen on the timeline.
This leaves only two possibilities. The first is that Hood has transcended the timeline, and the second is that there are special restrictions that hide him.
But it is unclear whether these two possibilities are good or bad for the world.
Because the current Hood seems to exist only in the present!
Whatever happens, there is absolutely no way to predict it.
There was fatigue in Gu Yi’s eyes.
“I hope everything is alright.”
“My time is short.”
New York, in the garden of the manor.
[Ding! You are remembered by Ancient One and have successfully passed the assessment! ]“It’s a test indeed.”
When he heard the prompt, Hood was not surprised at all.
Because Stephen and Wang suddenly appeared and said they had no way to break the spell.
He had already guessed that this was most likely someone sent by Ancient One to test him.
Because even if they have no way to break the spell, they should first look for Ancient One.
If they didn’t come to find him, there was only one possibility left, and that was what happened in the temple library last time.
Given Gu Yi’s character, he would send someone to test him sooner or later.
“Ancient One? I guess he’s starting to take me seriously.”
Hodder muttered to himself as he looked at the falling leaves in the distance.
He was not afraid of Gu Yi, as his current strength was evenly matched with Gu Yi.
A protracted war
Gu Yi might not even be as good as himself.
However, he has no hatred towards Ancient One. After all, this old guy is dedicated to protecting the earth.
There is no need to go over and find fault, especially since they are in the same camp.
“Just don’t bother me.”
Hodder shook his head. He just wanted to lie down and enjoy himself.
The reason why I want to become stronger is just to leave myself some power to protect myself.
What’s more, if the earth is gone, where will he go to play?
It’s impossible to go specifically to play with the purple sweet potato spirit, right?
“Wanda, what are you doing?”
Hod withdrew his thoughts and looked at Wanda in the living room.
At this moment, Wanda was lying on the sofa, swinging her white and tender little feet, making it impossible to take your eyes off her.
Especially the dark-colored sofa makes the skin look even whiter, and the exposed toes are pink and tender, which is particularly beautiful.
Even though he is not a foot fetishist, he couldn’t help but take a few more glances.
“Don’t look at my feet with those sly eyes of yours.”
Although Wanda didn’t get up, she knew what Hood was looking at without having to think about it.
“You can’t blame me for that. It was you who took the initiative to hook me!”
Hodder looked innocent.
“Pervert, you’re even interested in feet!”
Wanda curled her toes, “It really is a changing world.”
“I am interested in every part of you.”
Hodder smiled and said, “And there are so many things you can do with your feet and legs.”
Beep beep!!!
Just as he was about to continue teasing Wanda, Wanda’s cell phone on the table suddenly rang.
“Shh, it’s a call from the base.”
Wanda and Hod made a hushing gesture before answering the call.
But after a while, her expression immediately became extremely solemn, “What?!”
“Got it. I’ll go to support you immediately.”
After saying that, Wanda quickly got up.
Hod came to Wanda and spoke.
Wanda took a deep breath and spoke solemnly.
“There has been a mutation incident on North Street in Manhattan.”
Chapter 38: Bull Monster Attack, Close Encounter with Gwen! (Old Version)
A northern neighborhood of Manhattan.
The car suddenly exploded, and the impact of the blast even shattered the glass on the street nearby.
The debris piled up nearby was also ignited by the flames, and smelly black smoke slowly rose.
“Help! There’s a monster!”
“Why haven’t the Avengers come yet?”
“Don’t smash my beloved car that I just paid off the loan for!”
“Can someone help me find my child?”
The streets were filled with the screams and wails of the people.
Fear echoed in the air above the neighborhood.
Three bulls with horns and thick hair on their bodies were rampaging around the streets.
They destroyed everything they passed, even the streets on the side were overturned.
The crowd fled in all directions, and although they tried their best to escape, many people still suffered.
Police from nearby blocks rushed here as soon as possible and began to evacuate the people.
“Quick! Run this way!”
“Everyone, leave here, don’t stay!”
They were all trying their best to help with the evacuation, but even so, many people were still unable to evacuate.
Especially in the roadside shops, many people hid inside out of fear.
But the fragile glass door could not protect them at all.
Moo!!!
The bull man bent down, roared, and rushed towards the police car not far away.
Every step left a deep hoof print on the ground.
Looking at the bull-like man rushing towards them rapidly, the policeman’s face suddenly changed.
“FUCK!”
The policeman immediately put the car in reverse gear and stepped on the accelerator.
But because there were so many vehicles here, it crashed into something after driving only ten meters.
“Quick! Fight back!”
Seeing this scene, the policemen in the car had fear on their faces.
Although they wanted to draw their guns, at such a close distance, they could only watch in fear as the bull man got closer and closer.
At this moment, a pure white figure fell down and blocked the rushing bull man.
The cyclone vibrated and roared loudly.
A huge amount of energy burst out when the two collided, and even the dust swept around was rippling.
The police in the car instantly recognized the identity of the white figure.
The moment they saw the ghost spider appear, they finally felt relieved.
“Get out of here quickly, let me deal with these big guys!”
Gwen was holding the bull’s horns tightly with both hands, and his voice seemed to be squeezed out from between his teeth.
These damn guys are really strong!
Gwen couldn’t help but curse in her heart. These guys were far beyond her expectations.
The policeman looked at Gwen deeply, turned around and drove away from the sidewalk without saying a word.
Gwen took a deep breath, twisted his hips and waist, and threw the bull man in front of him away.
At this moment, the other two barbarians rushed towards this side with all their strength.
Seeing the two bulls getting closer, Gwen jumped high with confidence.
She is like a top gymnast, with a very resilient waist like a crescent moon.
At this moment, the bull man rushed over from below and crashed heavily into a shop nearby.
“Hey, it’s really rude of you to sneak attack! Don’t you have any tutors?”
After landing, playful Gwen did not forget to tease.
“Moo!!”
The bull man walked out of the store and roared to the sky.
“Scream? Just because you scream, you can destroy public property at will?”
Gwen crossed her arms and raised her head slightly.
The next second, three barbarians came galloping on the ground, shattering the ground, and rushed towards Gwen together.
“Do you really have the nerve to bully a little girl like me?”
“Even though you are the cows, you still have to respect the old and the young and be polite!”
As she spoke, Gwen felt the ground shake slightly, and the eyes in her spider mask suddenly widened.
She just sprayed out spider silk and quickly pulled herself into the air.
At the same time, his left hand quickly shot out spider silk continuously, wrapping around the bodies of the three barbarians.
The spider silk that was always effective was easily torn apart by the barbarian bull at this moment.
It can even barely delay for a few tenths of a second.
Faced with this scene, Gwen could only move quickly upstairs.
Then he continued to shoot out spider silk, but even so, he couldn’t stop the Barbarian Bull for too long.
“You guys are so strong, why don’t you go plow the fields?”
Gwen looked at the troublesome bull man and couldn’t help but mutter to herself.
The Barbarian couldn’t catch Gwen and went completely crazy, with strange black energy in his eyes.
Gwen was stunned when she saw the black gas coming out.
It was the first time she had seen such a strange thing.
At this moment, black substance condensed in the eyes of the three barbarians, and they suddenly looked up at the ghost spider.
Suddenly, black light burst out from their eyes.
Gwen’s eyes widened at this sudden scene.
“No, it’s too fast, there’s no way to dodge!”
When she was about to be hit, she could only barely turn sideways and avoid the black matter beam.
The spider silk that could connect high-rise buildings was also directly pierced by the rays at this time.
The whole person fell down without restraint.
“ah!”
Gwen couldn’t help but let out a scream.
When the minotaurs below saw Gwen so close, white air came out of their nostrils.
They all raised their horns excitedly, and if Gwen fell, she would inevitably collide with them.
“Oops!”
Seeing this scene, Gwen’s face changed drastically, and she suddenly wanted to turn around and shoot the spider silk towards the wall.
But now the distance is so close, it is difficult to change the falling situation!
What’s more, spider silk has a certain degree of elasticity, so it cannot be pulled at such a close distance!
Gwen stared at the blue sky with wide eyes.
“Am I going to die?”
She didn’t expect that these barbarians had such means of attack.
Otherwise she would never take it lightly.
However, at this moment, what greeted her was not the pain running through her body.
It was a warm embrace. She felt the strong chest and looked at it carefully.
At this time, the person who hugged her was actually Hood.
“We meet again.”
Hodder hugged Gwen, glided in the air for a distance, and landed steadily.
Looking at Gwen in his arms, he couldn’t help but secretly sigh, it’s so good to be young.
Even when I hold her, she’s soft.
Especially since she was wearing a tight outfit, the feeling of holding her was almost zero contact.
“What brings you here?”
Gwen was extremely surprised. She never expected that it was Hood who saved her at this critical moment.
She felt indescribable joy when she saw Hood, and even her right hand subconsciously rested on Hood’s shoulder.
Huo De was stunned for a moment and didn’t speak for a long time.
Because he hadn’t planned to come here in the first place.
Thinking that maybe I could get some rewards, I just followed Wanda here.
Who would have thought that they would arrive just in time to see Gwen falling.
Give it a hug, this trip is worth it.
“Hodder, why are you running so fast?”
Wanda flew over from a distance and saw Hood holding Gwen from afar.
She couldn’t help but raise her eyebrows and said with a strange look:
“Ghost Spider, why are you here too?”
………………
Chapter 39 Dark Magician, Horde’s waist strength has always been strong! (Old version)
“I heard someone calling for help, so I just came over.”
Gwen said subconsciously.
She had been planning to walk back to school through this block.
I just happened to come across this scene, so I took action without hesitation.
“By the way, Hod, won’t this affect the battle?”
Wanda stared at Hood’s hands which were moving subconsciously.
She felt sour inside, but she tried hard not to show it.
When Gwen heard this, she remembered that she was still being held by Hodder.
This made her face turn red instantly, and luckily she was wearing a mask, otherwise it would have been seen.
“Thank you, Mr. Hodder, please let me down!”
She quickly broke free from Hood’s arms, shot out spider silk, and lay on the wall of a building nearby.
Hod shook his head, recalling the feeling just now.
After all, we didn’t hold each other for long, which is a bit regrettable.
“Be careful, these three bulls don’t look like good people!”
Although Wanda was somewhat dissatisfied, she still shifted her gaze to the three barbarians below.
Just now she also noticed the energy bursting out of the eyes of these three barbarians.
“They are so weird. Black gas comes out of their eyes, and they can shoot out things like laser eyes.”
Gwen nodded in agreement. If it weren’t for that sudden skill, she wouldn’t have been shot down so easily.
Moreover, the speed of the black gas was so fast that even her spider sense couldn’t react.
As she spoke, she couldn’t help but focus her eyes on Hood who was standing beside her.
She remembered clearly that Hord’s eyes could also shoot out beams of light.
“wrong……”
Hod looked at the barbarians below and frowned slightly.
Because strictly speaking, this doesn’t belong to a human being at all.
Generally speaking, most of those who become monsters were originally humans.
But these awesome guys below are clearly humans transformed from cows!
Because from the appearance, body shape, and the horns on its head, you can tell that it was originally a cow.
The cow’s hooves alone look like the cow’s truest form when it stands up, and even its horns look old.
If it was really an acquired mutation, it would definitely not turn out like this.
“They are the product of dark magic!”
Hod had seen similar black magic on the Scroll of Sithorn when he was reading it.
Coupled with the power of the Phoenix in his body, he is more sensitive to black magic!
Combining their appearance, we can determine the origin of these barbarians.
“What?! These aren’t biological mutations, they’re actually products of magic!”
Wanda widened her eyes and looked at the barbarian below in disbelief.
Hood nodded solemnly, and it could be seen that this was definitely a planned event.
People who use black magic have strong purpose, and this matter is definitely not as simple as it seems.
“Moo!”
The barbarian below struggled to grab stones and other things and threw them at the people in the air.
The thrown rocks and debris even made explosive sounds.
Wanda stretched out her hands and shouted angrily, stopping all the debris from being thrown out.
At the same time, Hod had already landed on the ground.
When the three barbarians discovered that Hood had fallen, they were ecstatic, with red light dancing in their eyes.
As the ground shook, they rushed towards Hod at a rapid speed.
“careful!”
Although she knew that Hood was very powerful, Gwen couldn’t help but remind him.
During the fight, she discovered that the Barbarian Bull was very powerful.
The next second, Hood kicked out with a whip-kick so powerful that it even produced a sonic boom.
With a loud bang, the three barbarians were blown away.
They hit the ground far away with great force and rolled many times before finally coming to a stop.
Although he was not dead, he looked very miserable.
The originally thick fur had lost a large piece due to the friction with the ground, revealing the bloody muscles.
“This power is so terrifying!!!”
Watching this scene, Gwen suddenly remembered that even in terms of strength, Hood was the strongest one she had ever seen.
Even until now, she had never seen Hood use his full strength.
“His strength has always been strong.”
When Wanda said this, her eyes subconsciously glanced at Hood’s waist.
She has a deep understanding of this. This thing is simply a construction pile driver that never stops.
Moo!
The bull man flew backwards and struggled to get up from the ground, looking even more crazy.
Although he was seriously injured, he didn’t show any sign of stopping.
“Is this the power of black magic?”
Gwen muttered as she watched the horrific scene.
This was completely beyond her understanding, because in this situation, the Barbarian Bull’s body was not affected at all.
At the same time, the Barbarian growled and his eyes began to focus the black rays again.
Three rays shot out at the same time, and when they met in the air, they converged into a thicker black ray.
“Is that the only trick you have?”
Hod impatiently pulled with his right hand, and the small truck next to him blocked his way directly.
The moment the black rays focused on the truck, there was an instantaneous sizzling sound.
The car body looked like it had been splashed with high-concentration sulfuric acid, and it was even corroded continuously, leaving a large hole with an irregular black edge.
Judging from the continuously dissolving steel, the penetrating power of this ray is not strong. The scary thing is that it is corrosive.
“This actually has a corrosive effect?”
Hood couldn’t help but be a little surprised. This was indeed beyond his expectations.
Because it takes more than just black magic to change a cow into this look.
A lot of materials need to be prepared, otherwise there is no way for the Barbarians to have such powerful strength.
I thought it was just a small monster used to disrupt New York, but I didn’t expect it to be so powerful.
“It seems that the black magicians in New York are really generous.”
Hodder raised the corner of his mouth and murmured in a teasing tone.
At the same time, the barbarian who failed to hit the target did not stop.
Instead, he continued to condense those black rays, clearly intending to attack Hood with long-range means.
“Oh? They actually have a certain level of combat awareness? Or are these three barbarian bulls being controlled in real time by someone?”
Watching the actions of the Barbarian, Hood stroked his chin and pondered secretly in his heart.
Because even though these cows have become barbarians, their IQ should not have improved.
“Forget it, I don’t want to play anymore!”
Hod shook his head and threw those messy thoughts out of his mind.
There was a gleam of light in his eyes, and a dazzling beam of light blasted out!
Block the three concentrated black rays.
The moment the two energies intertwined, the black rays were instantly dissipated.
The golden rays instantly shone on the three barbarians, blasting them away.
Chapter 40: The annihilation power of the Phoenix Force, the power of the fire element, the relationship between the two of them seems to be wrong! (Old version)
The golden light instantly enveloped the barbarian bull.
The moment the bull man was hit, his body was pierced and melted by the golden light.
A large amount of black mist gushed out from the barbarian bull’s body.
At this time, the remaining body of the Barbarian Bull Man also began to turn into black mist.
The black fog continued to tangle and surge in the air, and even made roars and wails that sounded like they came from hell.
“What’s going on?!”
Gwen looked at this extremely strange scene, her eyes filled with fear.
She had faced many monsters, but she had never seen anything like this.
This was completely beyond her understanding. The black mist seemed to be alive.
It looked like countless black tentacles entangled in the air.
“This is the breath of death!”
Wanda could clearly feel that this large amount of black air exuded a disgusting aura.
“It looks like something interesting is going to happen.”
Hodder looked at this scene and did not rush forward to stop it. Instead, he crossed his arms and waited to see what would happen next.
This was the first time he faced an enemy using black magic, although he had some research on it.
But this is based on the Scroll of Sithon after all, and the branches of black magic developed subsequently will also be different.
At this moment, the black fog gathered in the air gradually became solid, and the eyes became deeper.
As the black fog dissipated, a huge bull-like man appeared in the black fog.
But this barbarian is very different from the previous barbarian.
Because its body was covered with all kinds of strange rune marks, and there was some flesh and blood on the pure black skin that was slowly stirring like granulation tissue.
roar!!!
This giant bull-man, more than ten meters tall, roared all day long.
The surrounding glass was shattered by the huge roar.
“After all this time, they actually came up with a combined skill?”
Hood touched his chin and nodded slightly with a smile. He had to admit that this did look interesting.
“This is unscientific. How on earth did they do this?”
This was undoubtedly a huge shock to Gwen.
It is incredible that a cow can transform into a humanoid monster, but it can actually become like this.
What’s more, this huge size completely violated her cognition.
Things like this are no longer something that should appear in this world!
And she had just clearly seen that the three bull men had been killed by Hood’s laser.
It’s not just a resurrection, it’s even grown that big!
“Is this magic?”
Wanda’s pupils shrank slightly. The giant bull-man that merged in front of her contained extremely terrifying power.
With a roar, dark flames began to appear on the skin of the giant bull man.
The extremely high flames even caused the surrounding air to distort.
The steel next to it also showed signs of melting due to the extremely high temperature.
The horrific heat wave caused the surrounding papers to show signs of spontaneous combustion.
“Oh my god, what kind of monster is this!”
The eyes on Gwen’s mask suddenly enlarged, which was completely a BUG.
Even though she was dozens of meters away, she could still clearly feel the waves of heat coming towards her.
It was like standing directly inside a furnace, and even the fabric that was close to the body felt stuck to it.
Just as they were hesitating, the giant bull man moved.
The giant bull man suddenly opened his mouth and roared, then raised his right leg and kicked the ground hard.
The asphalt road collapsed in an instant, and the cracks spread rapidly towards Hod.
What’s even more terrifying is that flames are bursting out from under the crack.
With just one kick, the entire street was suddenly ablaze, with flames in the cracks burning fiercely.
Gwen and Wanda couldn’t help but let out a cry of surprise when they saw the crack heading straight towards Hod.
At this moment, Hood looked at this scene without any movement, but instead showed a sneer.
Facing the oncoming cracks and bursting fire, he just slowly stretched out his right hand.
A red light appeared out of nowhere across the entire street.
The red light was like a giant barrier, enveloping the streets.
With a sudden clench of his fist, red light quickly flowed across the street.
The moment the crack, which was filled with tremendous force, came into contact with the red light, it was as if it had hit an invisible barrier.
It stopped instantly, and even the flames that followed were extinguished instantly at this moment, and the billowing flames dissipated.
In just a blink of an eye, all the flames disappeared.
As a breeze blew by, the high temperature just now seemed like a dream.
“Wow! How did you do that?!”
Gwen looked at the scene on the street in amazement: “This is so cool!”
Hood simply clasped his hands together, and the horrific flames disappeared in an instant!
This seems like a scene from a science fiction movie.
And Hood looks even more handsome when he uses this trick!
“Is this the correct way to use magic?”
Wanda, who possesses chaos magic, was very sensitive to the fluctuations of magic just now.
Because at that moment, an extremely terrifying force filled the streets.
It was suppressed with extremely terrifying force, so the flame disappeared instantly.
“I haven’t used the power of the Phoenix much, so it’s a little rusty.”
Hood just used the power of the Phoenix Force.
Let the fire die out.
The power of the Phoenix can turn dust into water and water into life.
Or it can turn everything into dust.
Even turned into nothingness.
Seeing that the fire was useless, the giant bull took huge steps and ran towards Hood.
Every step caused the ground to crack and the earth to shake. The flames burning all over the body burned the building black.
Even the footprints left behind were burning with black flames, as if they would never go out.
“Why are you yelling? It’s so annoying!”
Hood raised his hand and grabbed the air. An inexplicable force instantly clamped the giant bull’s mouth tightly like a giant hand.
Although the giant bull closed his mouth, he still ran towards this side with all his strength.
“I’m tired of playing. I don’t want to play anymore!”
Huo De shook his head, put his hand on the seal, and pressed down.
In just a moment, the giant bull man who was running stopped.
It was as if he was imprisoned in place by something, and fear flashed in his lifeless eyes.
The flesh on his body turned into dirt and scattered like quicksand. In just a few seconds, it turned into a pile of dust.
[Ding! You are about to destroy the bull monster while pretending to be awesome! ][Get reward: the power of the fire element! ]“Hod…”
Wanda was stunned. This move was so cool.
She was about to go over and celebrate with Hodder.
whoosh.
Gwen, who was standing beside him, rushed forward with an excited look, jumped up and hung on Hood: “Mr. Hood, you are so awesome!”
“???”
Wanda narrowed her eyes slightly, as if something was not right.
Shouldn’t you hold it yourself?
This seems a little wrong!
Chapter 41 Jealous Wanda, get her off you! (Old version)
Hod looked at Gwen hanging on him, then raised his head to see Wanda’s eager expression.
No, sister, please come down!
He felt that Wanda in the air could tear him apart alive.
Especially that look, it was like a wolf seeing his meat being taken away.
But feeling the ball hitting someone, he really didn’t want to let it go for a moment.
What’s more, it was clamped directly on his body, which made him feel inexplicably refreshed.
He now finally realized what excitement was.
“Cough cough cough…”
After a long while, Hodder smiled awkwardly and patted Gwen’s thigh: “Okay, you can let go of Miss Ghost Spider.”
I have to say, with these two hits, he could even feel the young man’s rebound.
This feeling almost made Hod want to learn from Goku and take out his weapon.
He really didn’t dare to be naughty anymore. God knew how angry Wanda would be.
“Oh, sorry, I was so excited!”
Gwen quickly let go of her hand, and was actually touched by Wukong’s weapon when she came down.
I didn’t expect that someone with such great abilities would actually carry a gun with him.
She couldn’t help but think secretly in her heart.
After all, it is surprising that someone with such strength would be so vigilant.
But she was too excited just now and just remembered that it was Gwen, not the Ghost Spider, who was familiar with Hodder.
“Okay, Tony will come and deal with the scene later.”
Wanda suppressed her anger and walked up to Hood and spoke in a muffled voice.
Moreover, she could also sensitively perceive that Gwen’s mental fluctuations towards Hood were strange.
Although it was not Hood who took the initiative to hug her, he was still filled with jealousy.
Even with this short sentence, Hood could feel the jealousy contained in it.
“Witch, it seems those media reporters are here to interview you!”
Hood suddenly noticed the reporters in the distance and quickly changed the subject.
I don’t want Wanda to continue to worry about this matter.
Because he also knew that Wanda could vaguely sense the fluctuations in his heart.
“But this time it’s not…”
Wanda was stunned, because this time she was just watching the show the whole time.
It would be inappropriate no matter how you look at it if she accepted an interview like this.
“I don’t like to be in the spotlight, and now the Avengers need to change their reputation.”
Hood shook his head, although the last incident had improved the public opinion outside to a certain extent.
But this is still limited after all. It would be a good thing for Wanda if she gave up the credit this time.
What’s more, he has already received rewards from the system.
Faced with such troublesome reporters, it would be better to leave it to Wanda to deal with.
“That……”
Wanda looked at the sincere look on Hood’s face and finally nodded.
What Hodder said is not wrong, because the Avengers really need these positive things to maintain attention now.
“Then Ghost Spider and I will go first!”
Hodder turned his gaze to Gwen, a barely perceptible smile flashing across his lips.
Wanda could only nod helplessly and stay to deal with these reporters.
As soon as the two left, a large number of reporters immediately surrounded them.
“Scarlet Witch, did you deal with the monster yourself this time?!”
“You are truly a hero to us in New York. Is it true that the monster is more than ten meters tall?”
“You didn’t flinch in the face of such a terrifying monster. Was it because of the people?”
“Did you suffer any serious injuries in this incident?”
Because the reporters only dared to approach after seeing the monster in the distance disappear.
So I have no idea what happened at the scene.
Seeing that Wanda was the only one here, people naturally thought that all of this was done by Wanda.
Wanda is really not good at lying, and there is a look on her face as if she wants to say something but hesitates.
But remembering what Hood had said, he could only nod with a stiff smile.
Looking at the reporters’ questions, she really felt overwhelmed.
Fortunately, Tony and Steve arrived at the critical moment and dispersed all the reporters.
A cordon was set up at the scene.
“Wanda, are you okay?”
Steve walked quickly to Wanda with a shield in hand and asked with a serious expression.
It can be seen from the situation at the scene that this will definitely be a very difficult battle.
Even everything on the ground and around it was affected.
It can even be said that the entire street was almost destroyed.
“I’m… I’m fine. I’m not hurt.”
Wanda pursed her lips and shook her head.
She watched the fight the whole time, and Hood alone was able to handle it all.
“You really are getting stronger!”
Steve looked at everything around him and couldn’t help but sigh.
Even Banner would probably be no more than this when he was angry.
Everywhere I looked, everything was in ruins.
“I didn’t kill that monster.”
Wanda took a deep breath and shook her head in denial.
Although Hood asked her to admit it, she was unwilling to deceive her friend.
And if it were her, it would definitely be difficult to deal with this monster.
The flames alone were enough to render her helpless.
“Who is that?”
Steve asked with a puzzled look on his face.
He didn’t expect that there was someone so powerful.
“I am… a mysterious person.”
Wanda shook her head in embarrassment. She didn’t know how to explain Hood’s existence.
“Okay.”
Tony, who had just dealt with the media, came here and looked at Wanda deeply, his mouth slightly open as if he wanted to say something but stopped.
But in the end, he turned his head away and forced himself to hold it back.
He knew very well that Wanda was definitely not lying, and this mysterious person was the one he most wanted to know.
Help Wanda learn to control magic and stand up to save the people at this time.
The more this happened, the more confusing he felt this person’s identity became.
He wanted to ask, but what Hood said came to his mind again.
Let’s wait for her to speak herself.
“Scarlet Witch!!!”
Wanda looked back in confusion.
A large group of people holding banners and shouting “Scarlet Witch” appeared outside the cordon.
“Those outside are all your fans.”
Steve looked at Wanda’s puzzled expression, smiled and said, “Go and leave them an autograph and take a picture.”
Wanda nodded, smiled and walked over to take a photo.
Yet she didn’t notice at all.
At the back of the crowd, there was a pair of strange blue eyes staring at her.
Those eyes were full of greedy desire.
“Chaos magic is really in her.”
The figure in the crowd was Agatha.
The woman’s eyes fell on the dust that the Barbarian Bull-Man had turned into within the cordon.
She couldn’t stop smiling, and her whole body was shaking with excitement: “There is actually the power of the Phoenix!”
What kind of opportunity did God give me!
Chaos magic and Phoenix force appear at the same time!
Agatha’s eyes were cold.
She wants both of these!
Chapter 42: The beautiful scenery reflected in the mirror, Gwen’s initiative at sunset! (Old version)
Queens, New York.
On the towering clock tower, a huge clock was ticking.
From the top floor, you can have a panoramic view of New York.
Pedestrians walked on the street, and as the sun set, more and more car lights were turned on.
Looking from above, it looks like strips of light-colored lights.
The orange-yellow light shining on the earth is like a beautiful oil painting.
At the top of the clock tower, two people sat on the edge of the top floor, looking at the distant scenery with a comfortable look.
Ever since Hood left Manhattan, he was brought here by Gwen.
“You really like looking at the scenery.”
Hod supported his body with his hands and tilted his head to look at the ghost spider beside him.
He found that Gwen liked places like this where she could enjoy the view.
Gwen nodded slightly, the corners of her mouth raised slightly, and there was a hint of laziness in her voice.
In the past, she always enjoyed the scenery alone, but now there is someone she can trust.
She felt a little more excited inside, which was very satisfying to her.
“It seems that you never get tired of seeing the scenery of Queens!”
Hod smiled and turned to look into the distance again.
“It’s not that I’m tired of seeing you, it’s because… you’re here.”
Gwen said as she took off her mask, revealing her cheeks which were slightly red from being suffocated.
When she said this, her heartbeat accelerated. For her, this was equivalent to a confession.
However, this is also the truest thought in her heart.
“You’ve even learned how to tease people, little Gwen.”
Hod placed his right hand on Gwen’s face and squeezed it, feeling the soft touch.
“whee……”
Faced with Hood’s actions, Gwen not only did not resist, but even moved a little closer.
Smelling the sandalwood scent of the cologne beside her, the corners of her mouth curled up slightly.
Although she didn’t know how Hood felt about her, she knew very well that she had fallen.
“By the way, have you ever seen New York in reverse?”
Gwen suddenly stood up and stretched her graceful curves, then turned her head excitedly to look at Hood beside her.
“New York after the reversal?”
Hood looked at Gwen with confusion. He really didn’t know what the reversed New York would look like.
“It’s just backwards! Idiot!”
Gwen shot out spider silk from her wrists and hung upside down on the roof.
The short golden hair fell down, shining brightly under the setting sun.
She smiled and looked at Hord expectantly: “Do you want to try it with me?”
“sure.”
Hodder did not hang upside down, but opened his hands and suddenly clasped them together.
At this moment, the scenery of New York suddenly turned upside down.
When Gwen saw this scene emerge, she was stunned.
“This is!!!”
Gwen returned to Hood’s side and looked at him with incredible eyes.
It was the first time she saw such a strange scene. It was an extremely strange feeling.
The world seemed to be turned upside down at this moment.
But she could clearly feel that this should only affect her senses.
“It’s just a little magic trick.”
Hodder smiled and shook his head, holding Gwen’s hand and sitting on the edge.
In fact, the whole world has not changed. He just used magic to change the world they were watching.
It is not the mirror space of Master Ancient One.
It must be said that this was the first time that Hood saw New York upside down.
It was as if the sky and the earth had exchanged places at this moment.
It was a completely different experience, as if the whole world was hanging upside down in the sky.
He couldn’t help but shift his gaze to Gwen who was standing beside him.
Although the scenery is beautiful, it is not as good as the beauty beside you.
The afterglow highlighted Gwen’s petite figure, her delicate face, her skin as white as snow, her willow-like eyebrows and starry eyes. Her golden hair fluttered in the autumn wind, making her look like a dynamic wallpaper.
Gwen sensed the burning gaze, looked over and their eyes met, her face immediately blushed: “Stop staring at me, look at the scenery.”
She couldn’t help but avert her gaze, but despite this, her keen spider sense could still detect the heat.
Her heart couldn’t help but be moved at this moment.
“Beautiful scenery should be matched with beautiful women.”
Hodder’s voice was calm as he spoke these words.
But the more this happens, the more it can touch people’s hearts.
“Isn’t the upside-down world very strange?”
Gwen’s flushed face felt hot and she quickly changed the subject.
However, the reversal of the situation at this time also gave her a completely new experience.
Especially with a man sitting next to her, Gwen’s heart beat faster as she had never been in love before.
“Yes, a little bit. It’s like seeing a whole new world.”
Hood nodded in agreement. He had never thought of looking at the world from this different perspective before.
Those eyes as deep as black gemstones looked towards the horizon again.
After sensing that Hood had shifted his gaze, Gwen looked at Hood cautiously.
It was dark, and the neon lights of the city reflected on his face, making it more angular and attractive.
Is this the person I love?
The more Gwen looked at it, the more she felt that Hod was like a black hole.
The black hole attracted her attention and she couldn’t even look away.
Gwen suddenly said, “I feel dizzy, I think I have a fever.”
“How could it be…”
Hood was shocked. Why did Gwen suddenly have a fever?
You know, Gwen is a ghost spider, and her physique is much better than that of ordinary people.
He didn’t care about anything else and quickly placed his left hand on Gwen’s forehead.
And the next moment, a warm hand touched Gwen’s forehead.
Gwen’s face also felt slightly hot, and even goose bumps appeared at this time.
“It’s a bit hot indeed.”
Hodder did feel his cheeks burning.
“You are really a fool…”
Gwen pouted and couldn’t help but mutter under her breath.
“But… your forehead does have a little…”
Just at this moment, when Hood wanted to say something, Gwen’s voice came again beside him.
“Change your approach.”
Gwen muttered quietly, her earlobes turning slightly red.
“What did you say?”
For a moment, Hood didn’t understand what Gwen was thinking.
But he also felt that something seemed to be wrong with Gwen’s current situation.
Accompanied by a fragrant breeze, the girl suddenly approached.
Huo De couldn’t help but hug the warm and soft girl in his arms tightly.
At the same time, he was somewhat incredulous.
Was I kissed forcefully?
The target is actually the innocent Gwen!
Chapter 43: What is the fever you are talking about? Wanda caught me and Gwen having a sweet moment! (Old version)
After a long time, the warmth between the two slowly separated.
Under the neon lights at night, both of their cheeks flushed slightly.
Gwen took a long breath, her cheeks became even hotter, and she even felt a little short of oxygen just now.
But this feeling made her very excited. She herself didn’t expect that she would be so bold.
She was clearly trying to get closer and closer, but she felt like a moth flying into a flame.
There was no way to control her emotions, she even wanted to get closer to Hood.
But after she came to her senses, her heartbeat quickened. She really didn’t expect that she would forcefully kiss Hood.
“So this is what you mean by fever.”
Hodder licked his lips and teased with a smile.
I really didn’t expect that Gwen would have such a passionate side.
Before, she kissed on the cheek, but now she went straight to the mouth. This was beyond his imagination.
“You…don’t say it.”
Gwen’s cheeks were flushed and she felt her whole body was burning hot.
This was said directly, and she was so embarrassed that she didn’t know where to put her hands.
“But it’s really soft…”
Hodder looked at her lips and a bold idea came to his mind.
It has to be said that this further increased his desire.
“No… don’t say anything. And can you please put the gun on your waist from now on? Otherwise, it will hurt you.”
Gwen pouted and spoke with red cheeks. She had been holding it in while he was holding her.
This made her feel a little uncomfortable, yet comfortable.
“You dare to do it but you don’t dare to admit it? I didn’t expect Ghost Spider to be so bold.”
Hodder looked at the soft Gwen in his arms, noticed her shy look, and couldn’t help but continue to tease her: “And why do you look like you were molested? I’m the one who was forced!”
“Stop talking, shut up!”
Hearing this, Gwen wished she could turn into a spider and find a crack in the ground to crawl into. She herself didn’t know why she was so impulsive.
I only felt my eardrums bulging and I could even hear the beating of my own heart.
But holding his own Hood, he felt extremely happy.
Of course, it would be better if that painful thing stopped hurting me.
“Why, you feel uncomfortable?”
Hood gripped her thigh and lifted it up, and the two of them got closer, and could even feel the breath hitting her face.
Being so close to each other, the two looked directly into each other’s eyes, as if they could see into each other’s hearts.
“Yeah, a little bit, because you’re a terrible, terrible kisser!”
Even though Gwen hadn’t been kissed, she couldn’t help but speak back.
She couldn’t possibly say that she felt comfortable, or she would be laughed at.
“Really? Then it seems I still need to practice with you!”
Hodder put his arm around her waist, and this time it was not Gwen who took the initiative.
All of this made Gwen feel like she was sucking on candy.
It’s so delicious that you can’t help but lick it.
Three or four minutes passed.
The two then separated.
Gwen gasped.
Even her eyes became blurred at this moment, and her gaze was entangled with Hood like glue.
It seemed as if at this moment, they were the only two people left in the world.
“What? Are you feeling better? Can’t you continue?”
Hodder looked at the seductive Gwen, his lips curled up, and he spoke seductively like a devil.
“No! I can’t breathe.”
Gwen dodged quickly. She felt like she was about to become a river.
If this continues, it will be really embarrassing.
After all, although her spider suit is waterproof, it is still sticky and uncomfortable.
Watching Gwen dodge like a little rabbit, Hod laughed even more happily.
Although he had seen many flowers, this budding flower gave him a different experience.
However, at this moment, a blue light flashed across the sky.
What followed was a downpour, with raindrops as big as beans hitting the street.
In just less than ten seconds, everything within sight was covered by heavy rain.
Countless rain lines slid down the sky and poured down on the earth impatiently.
The pedestrians on the street ran quickly towards the nearby rooftops.
The torrential rain and strong wind came towards them.
“Ah…”
Gwen was instantly drenched by the rain.
“Let’s find a place to hide from the rain!”
Hodder looked at the narrow roof and took the initiative to speak.
There is no way to avoid the heavy rain at this location.
What’s more, it’s late at night and we have to leave.
“Where are you going?”
Gwen frowned and asked, grabbing her own battle suit.
Although her battle suit was waterproof, rain still seeped in through the collar.
She was already feeling wet and sticky and felt even more uncomfortable. She could even feel that her inner garment was soaked.
“Come to my house!”
The corners of Hood’s mouth rose, and without saying a word he put his arms around Gwen’s slender waist.
Gwen felt the breath so close at hand, and the next second she was in the air.
She only felt that she was being held by Hood and flying away.
The rain from the sky kept hitting the two of them.
But Gwen, who was carried like a princess, forgot all this.
The only three words that Hood had just said remained in her mind.
Go to his house?!
Could this be?
Just as she was stunned, a golden light appeared.
They appeared in a manor-style villa.
Gwen was stunned looking at the golden chandelier.
“Where is this place?”
It should have taken less than a few seconds in total!
She looked out the window, but what appeared before her was not a tall building.
Instead, there were dense forests, and even the heavy rain did not reach here.
All you could see was the strong wind blowing through the trees, which were swaying slightly in the wind.
“My home.”
Hodder didn’t let Gwen go, but hugged her tighter.
“How did you do that?!”
Gwen was confused. She had no idea why she appeared in another place in the blink of an eye.
Is there really anyone in the world who can run that fast? !
“It’s a secret.”
Hodder didn’t say it, but looked at Gwen’s figure in his arms under the bright light.
Because of the penetration of rain, the tights also stuck tightly to the body.
The water flowing inside is like small streams, and the tights that fit tightly against the body appear even more seductive.
“You… stop looking!”
Gwen noticed this and jumped off Hod without saying a word.
She even covered her chest in shame.
But deep down I couldn’t help but feel a little happy.
Because Hood seems to like his figure very much.
“Don’t look at it, go take a shower first, and I’ll help you prepare your clothes.”
Hord’s mouth was dry and he looked away.
“Where’s the bathroom?”
After asking where the bathroom was, Gwen swayed her sexy body and ran towards the bathroom on the second floor.
“Imelda, please order a set of clothes for me!”
Hodder pressed the button embedded in the wall and notified the maid who lived not far away through the intercom.
“Boom boom boom.”
There was a sudden knock on the villa door.
Because at night, the maids all went back.
So Hood had to go and open the door himself.
But the moment he opened the door of the villa, he was stunned.
“Wanda?!”
He never expected that the person coming over was Wanda: “Why are you here?”
He had just brought Gwen back, and now Wanda was here too. He didn’t know what to do for a moment.
“What’s wrong? Don’t you miss me?”
Wanda looked at Hood, whose expression was stiff, with tired eyes.
The moment he saw Hood, his tense mood relaxed.
She herself didn’t expect why she would be so bold to come here directly.
But what she knew was that she missed Hood now.
“Of course I do…”
Hood’s expression was strange, and even his heartbeat quickened slightly.
I guess I can’t keep this manor anymore.
He couldn’t even imagine if Wanda would go crazy if she saw this scene.
“By the way, someone just delivered clothes to the door, and I brought them in for you.”
Wanda opened the bag with a puzzled look, and what caught her eyes were two sets of youthful clothes: “Is this what you prepared for me?”
“That’s right…”
Huo De’s heart tightened, and he nodded stiffly.
He couldn’t possibly say this was for Gwen!
However, at this time.
A girl’s tender cry came from the room on the second floor, “Hodder, where are my clothes?!”
Damn, we met again!
Huo De’s heart was suddenly gripped.

